Lus10019504 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019504 pacid=23181479 polypeptide=Lus10019504 locus=Lus10019504.g ID=Lus10019504.BGIv1.0 annot-version=v1.0
ATGGCCTCCACTCGCTGCTGCTTCCTCCTCTACAACTTATTGCGCGGTGGTGGGTTTGGTTTGCGGTCAATCTCATTCCTCTGCCTCCAGAGCTGCAGTG
AGAAACTCTACCCTTCTTTCCAAATCGATCAAGACAAGATCTCCAGTGCCATCAACCCTCTAAGGAGCAACATCAACGGGTCCTTAGCCTACTATGTCGA
GTCTATAACAAGCTCGAAACAAGGGAACCTGCTCGCCGGTGCCGCCGCGGGCTATGGACAGATTTTCGTCTCCGATGAGTCGGCCATGGGAGATGGAAAT
AACCCCTCTGTCTTCTCTCCCTTGATAGCCGTCGAGGGCTATGGCTCCCAAAAGCTAAAAGATAGCTTCAGTACCCCACCACTCTTAAAGAAGAAAGCTC
CAAAGTGA
AA sequence
>Lus10019504 pacid=23181479 polypeptide=Lus10019504 locus=Lus10019504.g ID=Lus10019504.BGIv1.0 annot-version=v1.0
MASTRCCFLLYNLLRGGGFGLRSISFLCLQSCSEKLYPSFQIDQDKISSAINPLRSNINGSLAYYVESITSSKQGNLLAGAAAGYGQIFVSDESAMGDGN
NPSVFSPLIAVEGYGSQKLKDSFSTPPLLKKKAPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019504 0 1
AT4G38830 CRK26 cysteine-rich RLK (RECEPTOR-li... Lus10002371 7.1 0.8482
AT1G20640 NLP4 Plant regulator RWP-RK family ... Lus10013224 16.1 0.7780
Lus10043307 17.1 0.8415
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10002933 23.5 0.8259
AT1G31650 ATROPGEF14, ROP... RHO guanyl-nucleotide exchange... Lus10033282 24.6 0.7132
AT1G11340 S-locus lectin protein kinase ... Lus10013247 27.3 0.7123
AT4G37260 MYB ATMYB73 myb domain protein 73 (.1) Lus10040940 27.3 0.6894
Lus10019410 29.2 0.8119
AT5G07380 unknown protein Lus10043018 31.9 0.8051
AT5G03610 GDSL-like Lipase/Acylhydrolase... Lus10028145 34.3 0.8117

Lus10019504 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.