Lus10019509 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26667 218 / 5e-73 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT3G60180 194 / 1e-63 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT3G60961 177 / 5e-58 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G25280 154 / 3e-47 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G37250 52 / 2e-08 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 50 / 1e-07 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031611 238 / 1e-80 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10033733 238 / 1e-79 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10031135 153 / 3e-47 AT4G25280 263 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10031714 154 / 4e-44 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10040358 56 / 9e-10 AT2G37250 405 / 1e-143 adenosine kinase (.1)
Lus10023476 54 / 6e-09 AT2G37250 407 / 2e-144 adenosine kinase (.1)
Lus10030296 52 / 3e-08 AT2G37250 395 / 1e-139 adenosine kinase (.1)
Lus10001984 51 / 5e-08 AT2G37250 391 / 4e-138 adenosine kinase (.1)
Lus10009228 42 / 6e-05 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G043300 226 / 2e-76 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.002G134600 220 / 5e-74 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.014G104700 179 / 9e-58 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.015G129000 151 / 2e-46 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.010G215300 52 / 2e-08 AT2G37250 382 / 2e-134 adenosine kinase (.1)
Potri.008G046100 52 / 2e-08 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.001G333100 40 / 0.0002 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Lus10019509 pacid=23181520 polypeptide=Lus10019509 locus=Lus10019509.g ID=Lus10019509.BGIv1.0 annot-version=v1.0
ATGGATTTTGAGGTTCTTACATTTGAATCTCATGCAGCTTTCTCACCGGCTACATTAACAACAGTAACATGGGAGCTTCCGTCGAAGCTGGAAACACGAA
CCATGATCCAGAACATGATTAAGGAGGGAAAGATTGTGCCCTCTGAGGTGACAATAAAGCTTCTTGAGAAGGCAATACTGGATAATGGAAATGACAAATT
CCTTATTGACGGTTTTCCACGCAATGAGGAAAACAGGGCTGCATTTGAAGCTGTTACAAAGATTGAGCCAGAATTCGTCCTCTTTTTTGATTGTCCAGAA
GAAGAGATGGAAAGGAGGATTTTGAGTAGGAACCAGGGAAGAGAAGATGATAACATTGAGACAATAAGGAAGCGTTTCAAAGTATTTCTTGAGTCTAGCC
TTCCAGTGGTTGAGTATTATGCTTCCAAGGGTAAAGTTAAGAAGCAGGTTATAGCTATAAAATTCGAGTAA
AA sequence
>Lus10019509 pacid=23181520 polypeptide=Lus10019509 locus=Lus10019509.g ID=Lus10019509.BGIv1.0 annot-version=v1.0
MDFEVLTFESHAAFSPATLTTVTWELPSKLETRTMIQNMIKEGKIVPSEVTIKLLEKAILDNGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCPE
EEMERRILSRNQGREDDNIETIRKRFKVFLESSLPVVEYYASKGKVKKQVIAIKFE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26667 PYR6 P-loop containing nucleoside t... Lus10019509 0 1
AT5G11710 ENTH/VHS family protein (.1) Lus10005498 2.0 0.9067
AT3G23690 bHLH bHLH077 basic helix-loop-helix (bHLH) ... Lus10041261 2.0 0.9040
AT5G27490 Integral membrane Yip1 family ... Lus10031511 2.8 0.8708
AT1G08750 Peptidase C13 family (.1.2.3) Lus10006571 3.0 0.9013
AT1G31070 GlcNAc1pUT1 N-acetylglucosamine-1-phosphat... Lus10036227 3.2 0.8689
Lus10019700 3.3 0.8687
AT5G26667 PYR6 P-loop containing nucleoside t... Lus10033733 3.5 0.8959
AT4G21215 unknown protein Lus10006757 6.2 0.8564
AT2G44060 Late embryogenesis abundant pr... Lus10008337 7.3 0.8147
AT1G34550 EMB2756 EMBRYO DEFECTIVE 2756, Protein... Lus10028702 8.1 0.8922

Lus10019509 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.