Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043356 [exp] 79 / 3e-20 AT2G35300 43 / 3e-06 late embryogenesis abundant 18, late embryogenesis abundant 4-2, Late embryogenesis abundant protein, group 1 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G178900 [exp] 44 / 3e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019512 pacid=23181498 polypeptide=Lus10019512 locus=Lus10019512.g ID=Lus10019512.BGIv1.0 annot-version=v1.0 ATGCAGGCTGTGAAAGAGAAGATCCAAGACATGAAAGAGATGCGCAAGGTCAAGGCTGAAGCCAAGGCCGAAGAGAAGGTAAAAGTAGCCCATTGCCTTG ATGGAATTGTCTGTATTTTGAATAATGATGATACTGTTGTGCAGGCGGAGAAGGAGGTCGCAAAGGCGAGGATGGAGGTTGCGAAAGAGGTGAGGATGGC GAGAGAAGCTCAAGCAGAAATGCAACTCCATGCATCTAAAGCTGGCGAAAAGTCCGTCGCCAAAACTCCTTTAGATGCTGCCGGTGCATCAGCCACTACT ACCACCACGAGCACTACCACCACCACTGACAGAACTTCTGCATAA
AA sequence Show only first row Show all	>Lus10019512 pacid=23181498 polypeptide=Lus10019512 locus=Lus10019512.g ID=Lus10019512.BGIv1.0 annot-version=v1.0 MQAVKEKIQDMKEMRKVKAEAKAEEKVKVAHCLDGIVCILNNDDTVVQAEKEVAKARMEVAKEVRMAREAQAEMQLHASKAGEKSVAKTPLDAAGASATT TTTSTTTTTDRTSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019512 [exp]	0	1
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	3.6	0.8066
					Lus10003479 [exp]	5.7	0.7920
					Lus10024012 [exp]	7.1	0.7764
AT5G52850			Pentatricopeptide repeat (PPR)...		Lus10038834 [exp]	7.7	0.7443
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	12.4	0.7552
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10003459 [exp]	16.3	0.7660
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10004224 [exp]	16.7	0.7139
AT3G46570			Glycosyl hydrolase superfamily...		Lus10000070 [exp]	19.1	0.7486
AT4G30030			Eukaryotic aspartyl protease f...		Lus10031450 [exp]	30.3	0.7640
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	41.1	0.7389

Compare expression of checked genes

Lus10019512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.