Lus10019515 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019515 pacid=23181580 polypeptide=Lus10019515 locus=Lus10019515.g ID=Lus10019515.BGIv1.0 annot-version=v1.0
ATGTTCGTGACAGCCTGGAGTGGGCTGCCGACCACCGTGCGACTGCAGTCGGAGAATGGAAATGTCATCAACGGCGACACCACTGATTACAAGAGGAAAG
AAAAGAAGGGGCAAATGGAACAACCATGTATCTTCCCGCAGCTGTCCCGCAGAAACCCATCGTGGCTTGCAGTGGCTTGTTCCCCTGTTATCCATGTATG
GGGACTGGAGAACGCAAGGATGTCTCCGGTTTCAACTTCCCCGGATGAGTACCGGATCACTACCCAGAAGGCAGCAACTAAGAAAGCTGCAGTAGATCAT
CTGCATCATGGTAGATGTTTTCAGCCATCTGCCATATCTGAAGAATGTTATCTTCAGCAAACACTCGCGACGACCCAGTCTTCACAAGGATTCCAGGAAA
AATCGTCTGATATTTTACTGGTGTGGCTCCGAAGAAACGCATAA
AA sequence
>Lus10019515 pacid=23181580 polypeptide=Lus10019515 locus=Lus10019515.g ID=Lus10019515.BGIv1.0 annot-version=v1.0
MFVTAWSGLPTTVRLQSENGNVINGDTTDYKRKEKKGQMEQPCIFPQLSRRNPSWLAVACSPVIHVWGLENARMSPVSTSPDEYRITTQKAATKKAAVDH
LHHGRCFQPSAISEECYLQQTLATTQSSQGFQEKSSDILLVWLRRNA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019515 0 1
AT4G15620 Uncharacterised protein family... Lus10041528 2.8 0.9318
AT5G65120 unknown protein Lus10000581 4.2 0.8804
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10009282 4.2 0.9038
AT4G37810 unknown protein Lus10007240 6.9 0.8970
AT4G03400 GH3-10, DFL2 DWARF IN LIGHT 2, Auxin-respon... Lus10039797 7.5 0.8764
AT5G17680 disease resistance protein (TI... Lus10005174 11.4 0.8407
AT3G55240 Plant protein 1589 of unknown ... Lus10003293 11.9 0.8401
AT4G38380 MATE efflux family protein (.1... Lus10020203 12.3 0.8579
AT3G22210 unknown protein Lus10003811 12.8 0.8696
AT5G67360 ARA12 Subtilase family protein (.1) Lus10029575 13.7 0.8880

Lus10019515 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.