Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27550 117 / 1e-34 ATC centroradialis (.1) AT5G03840 103 / 5e-29 TFL-1, TFL1 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT5G62040 89 / 1e-23 BFT brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT1G65480 82 / 1e-20 FT FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT4G20370 76 / 2e-18 TSF TWIN SISTER OF FT, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) AT1G18100 56 / 1e-10 MFT, E12A11 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043385 [exp] 151 / 7e-48 AT2G27550 259 / 2e-89 centroradialis (.1) Lus10020600 [exp] 124 / 2e-37 AT2G27550 263 / 3e-91 centroradialis (.1) Lus10004886 [exp] 117 / 2e-34 AT2G27550 267 / 2e-92 centroradialis (.1) Lus10004884 [exp] 112 / 2e-32 AT2G27550 218 / 3e-73 centroradialis (.1) Lus10015520 [exp] 103 / 4e-30 AT2G27550 92 / 3e-25 centroradialis (.1) Lus10019541 [exp] 105 / 5e-30 AT2G27550 188 / 5e-62 centroradialis (.1) Lus10021372 [exp] 105 / 5e-30 AT5G03840 267 / 1e-92 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10017052 [exp] 100 / 3e-29 AT5G03840 108 / 2e-31 TERMINAL FLOWER 1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Lus10027442 [exp] 96 / 8e-26 AT5G62040 248 / 4e-85 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G203900 [exp] 124 / 2e-37 AT2G27550 286 / 4e-100 centroradialis (.1) Potri.009G165100 [exp] 122 / 2e-36 AT2G27550 293 / 7e-103 centroradialis (.1) Potri.015G141300 [exp] 99 / 9e-28 AT5G62040 217 / 1e-73 brother of FT and TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.008G077700 [exp] 82 / 1e-20 AT1G65480 257 / 8e-89 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179900 [exp] 75 / 7e-19 AT1G65480 132 / 6e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179801 [exp] 75 / 7e-19 AT1G65480 133 / 3e-41 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.010G179700 [exp] 76 / 2e-18 AT1G65480 286 / 2e-100 FLOWERING LOCUS T, PEBP (phosphatidylethanolamine-binding protein) family protein (.1) Potri.015G041000 [exp] 60 / 4e-12 AT1G18100 291 / 2e-102 MOTHER OF FT AND TFL1, PEBP (phosphatidylethanolamine-binding protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01161 [flax] [poplar] PBP Phosphatidylethanolamine-binding protein
Representative CDS sequence Show only first row Show all	>Lus10019518 pacid=23181605 polypeptide=Lus10019518 locus=Lus10019518.g ID=Lus10019518.BGIv1.0 annot-version=v1.0 ATGTCGTCGTCAGATCCTCTAGTGATAGGTAGAGTGATTGGAGATGTTGTTGATGGATTGAATCCAAGTCCTGTGAAGATGGCAGTCACTTACAGCTCTG CTAATAAACAAGTGTTCAATGGCCATGAGTTCTTCCCTTCTGCTGTTACTCAGAAGCCTAAGGTTGAAGTTCTTGGTGGTGATCTCAGGTCCTTCTTCAC TCTGGTGATGACAGACCCAGATGTGCCTGGTCCAAGTGATCCATATCTGAGAGAGCACTTACACTGGTTTGTACCATACACGCATAACATTTGTTGTCAT AATATGCATGGTCCTCCACTTGCCAAAATAGAAGGATGA
AA sequence Show only first row Show all	>Lus10019518 pacid=23181605 polypeptide=Lus10019518 locus=Lus10019518.g ID=Lus10019518.BGIv1.0 annot-version=v1.0 MSSSDPLVIGRVIGDVVDGLNPSPVKMAVTYSSANKQVFNGHEFFPSAVTQKPKVEVLGGDLRSFFTLVMTDPDVPGPSDPYLREHLHWFVPYTHNICCH NMHGPPLAKIEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27550		ATC	centroradialis (.1)		Lus10019518 [exp]	0	1
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10012818 [exp]	1.0	0.8015
AT3G46170			NAD(P)-binding Rossmann-fold s...		Lus10006696 [exp]	10.5	0.7955
AT5G20260			Exostosin family protein (.1)		Lus10005186 [exp]	23.0	0.7794
AT5G14920			Gibberellin-regulated family p...		Lus10014519 [exp]	24.8	0.7407
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Lus10023620 [exp]	29.4	0.7201
AT5G46230			Protein of unknown function, D...		Lus10001891 [exp]	34.3	0.7377
AT4G18335			unknown protein		Lus10028125 [exp]	82.5	0.6322
AT4G05220			Late embryogenesis abundant (L...		Lus10018376 [exp]	97.4	0.6974
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10008259 [exp]	101.0	0.6801
AT2G30210		LAC3	laccase 3 (.1)		Lus10026400 [exp]	114.1	0.6427

Compare expression of checked genes

Lus10019518 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.