Lus10019550 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17420 202 / 4e-65 NTR2, ATNTRA, NTRA NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
AT4G35460 195 / 4e-62 ATNTRB, TRB1, NTR1 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 1, NADPH-dependent thioredoxin reductase B (.1)
AT2G41680 120 / 1e-32 NTRC NADPH-dependent thioredoxin reductase C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025845 233 / 3e-78 AT2G17420 437 / 7e-155 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Lus10038256 232 / 5e-78 AT2G17420 442 / 1e-157 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Lus10006853 209 / 4e-64 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10018051 120 / 1e-32 AT2G41680 845 / 0.0 NADPH-dependent thioredoxin reductase C (.1)
Lus10042048 120 / 2e-32 AT2G41680 840 / 0.0 NADPH-dependent thioredoxin reductase C (.1)
Lus10037596 99 / 2e-27 AT2G17420 241 / 2e-80 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G456800 212 / 9e-69 AT2G17420 582 / 0.0 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Potri.011G145100 201 / 2e-64 AT2G17420 568 / 0.0 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Potri.006G049100 117 / 2e-31 AT2G41680 785 / 0.0 NADPH-dependent thioredoxin reductase C (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Representative CDS sequence
>Lus10019550 pacid=23169911 polypeptide=Lus10019550 locus=Lus10019550.g ID=Lus10019550.BGIv1.0 annot-version=v1.0
ATGGTGAGCAAGGTCGATTTCTCTTCCATTCCATTCAAGGTTTTCACCCATTCGAAGACCGTCCCCGCCGATACCGTCGTGGTTTCCACCGGCGCAATGG
AAAAGCGGCTTCAGTTCTTTAGGTCGAAGACTTTCTTGAACCGAGGAATATCAGCCTGTGCGGTCTGCGAGGGCGCCACCCCAATTTTCAGGAACAAGCC
GCTGGTGGTGATCGGCGGAGGGGATTCTGCAATGGATGAAGCGAATTTGTTGACCAAGTATGGTAGCAAAGTGTACATCATCCACATGAGGGATACTTTC
AGGGCGTCCAAGATAATGCAGAATAGGACTTTGACGAACCCTAAGATAGAGGTGGTGTGGAATTCGATGGCGGAGGAGGCTGATGCAGAGAATAATCGAG
GTGGTTTGAAGACAATGGCACCCTCAAGCCTGCTAGACTAG
AA sequence
>Lus10019550 pacid=23169911 polypeptide=Lus10019550 locus=Lus10019550.g ID=Lus10019550.BGIv1.0 annot-version=v1.0
MVSKVDFSSIPFKVFTHSKTVPADTVVVSTGAMEKRLQFFRSKTFLNRGISACAVCEGATPIFRNKPLVVIGGGDSAMDEANLLTKYGSKVYIIHMRDTF
RASKIMQNRTLTNPKIEVVWNSMAEEADAENNRGGLKTMAPSSLLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17420 NTR2, ATNTRA, N... NADPH-DEPENDENT THIOREDOXIN RE... Lus10019550 0 1
AT5G52790 CBS domain-containing protein ... Lus10027527 3.7 0.7497
AT2G24370 Protein kinase protein with ad... Lus10027593 7.9 0.7397
Lus10004437 9.6 0.7397
AT5G28690 Protein of unknown function (D... Lus10005536 11.1 0.5652
Lus10021739 11.1 0.7397
AT3G08030 Protein of unknown function, D... Lus10029502 12.4 0.7397
AT2G29880 unknown protein Lus10005028 13.0 0.6832
AT5G02910 F-box/RNI-like superfamily pro... Lus10000727 13.6 0.7397
Lus10039674 14.7 0.7397
AT3G18170 Glycosyltransferase family 61 ... Lus10032454 15.7 0.7397

Lus10019550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.