Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51105 37 / 0.001 Protein of unknown function (DUF1278) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032886 [exp] 132 / 1e-40 AT5G52975 52 / 1e-09 Protein of unknown function (DUF1278) (.1) Lus10001307 [exp] 129 / 2e-39 AT5G52975 44 / 2e-06 Protein of unknown function (DUF1278) (.1) Lus10027141 [exp] 126 / 4e-38 AT5G52975 46 / 5e-07 Protein of unknown function (DUF1278) (.1) Lus10019549 [exp] 115 / 7e-34 AT5G51105 49 / 4e-08 Protein of unknown function (DUF1278) (.1) Lus10019428 [exp] 78 / 2e-19 AT2G14378 50 / 1e-08 Protein of unknown function (DUF1278) (.1) Lus10043285 [exp] 78 / 2e-19 AT5G51105 47 / 1e-07 Protein of unknown function (DUF1278) (.1) Lus10028291 [exp] 78 / 9e-19 AT2G14378 44 / 8e-06 Protein of unknown function (DUF1278) (.1) Lus10019101 [exp] 76 / 4e-18 AT2G14378 50 / 3e-08 Protein of unknown function (DUF1278) (.1) Lus10034455 [exp] 74 / 7e-18 AT2G14378 49 / 5e-08 Protein of unknown function (DUF1278) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10019552 pacid=23169922 polypeptide=Lus10019552 locus=Lus10019552.g ID=Lus10019552.BGIv1.0 annot-version=v1.0 ATGGTGGTGAGAGGATTCGCAACTTGCATTGTTTTGGTATCAATACTAATCCTATCAGCCGCTGCTTCGATTGGACCAACAGCAACAACAACAATGTCGT CGACAATGTGTAGAACAGGGAAGTTGGGTCCAGAAGTTGCAGCGAAATGTTGGCTGGTAATTTTGGAGGTTCCAATCTGTATATTTGAGATTGTGGAGGT TTACGAAGGAGCTTCCATCTTTAAACTCACTCGCTCTTGTTGTCGTGCGATTATAGACCTCACTCAAGACTGTAAGATGGAGATTTTCCAGGATTCCAAG TTGTTTCCTGCCATTCACAATTTTTGCACTGCCATTAGCAGAGGAGTAAGTAGTGGCCTTGTTCATTCTCTACCTCCTACCTAG
AA sequence Show only first row Show all	>Lus10019552 pacid=23169922 polypeptide=Lus10019552 locus=Lus10019552.g ID=Lus10019552.BGIv1.0 annot-version=v1.0 MVVRGFATCIVLVSILILSAAASIGPTATTTMSSTMCRTGKLGPEVAAKCWLVILEVPICIFEIVEVYEGASIFKLTRSCCRAIIDLTQDCKMEIFQDSK LFPAIHNFCTAISRGVSSGLVHSLPPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51105			Protein of unknown function (D...		Lus10019552 [exp]	0	1
AT3G05550			Hypoxia-responsive family prot...		Lus10033002 [exp]	5.4	0.9330
AT3G10920		MSD1, MEE33, AT...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10030534 [exp]	13.1	0.9316
AT5G25940			early nodulin-related (.1)		Lus10030052 [exp]	15.4	0.9313
AT1G49230			RING/U-box superfamily protein...		Lus10033515 [exp]	16.7	0.8108
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10036719 [exp]	17.3	0.8903
AT1G43800			Plant stearoyl-acyl-carrier-pr...		Lus10018926 [exp]	20.5	0.9245
					Lus10002596 [exp]	20.7	0.9310
AT4G34640		ERG9, SQS1	squalene synthase 1 (.1)		Lus10017499 [exp]	24.0	0.9167
AT3G50390			Transducin/WD40 repeat-like su...		Lus10016779 [exp]	24.5	0.9293
AT5G11420			Protein of unknown function, D...		Lus10005474 [exp]	28.0	0.9126

Compare expression of checked genes

Lus10019552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.