Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043004 [exp] 97 / 1e-25 ND 47 / 8e-06 Lus10012388 [exp] 71 / 4e-17 ND / Lus10010602 [exp] 61 / 1e-13 ND 35 / 0.010 Lus10017834 [exp] 61 / 2e-13 ND / Lus10005472 [exp] 50 / 4e-09 ND / Lus10005473 [exp] 48 / 6e-09 ND / Lus10019612 [exp] 44 / 5e-07 ND / Lus10022156 [exp] 45 / 6e-07 ND / Lus10005607 [exp] 37 / 0.0004 ND 38 / 0.003
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019558 pacid=23169923 polypeptide=Lus10019558 locus=Lus10019558.g ID=Lus10019558.BGIv1.0 annot-version=v1.0 ATGATGGATGGCCATGTGTGTGACACAGAAGGAAGTAGCACTAGCGAAGGTTATGATACAACATTTGAAGCGGCTAAAATGTATATCATGGATGACATTG TGAAGAAATGGAGAGACTATCGAGTTCGGATATGGAAAGACCAGGTGCTGAAAAATAAACACATCCCAAAACCACTCTCTGCACAAGCTTTTAGAGCAGC TTGTATTACAGCCAAGCCTGAGTAG
AA sequence Show only first row Show all	>Lus10019558 pacid=23169923 polypeptide=Lus10019558 locus=Lus10019558.g ID=Lus10019558.BGIv1.0 annot-version=v1.0 MMDGHVCDTEGSSTSEGYDTTFEAAKMYIMDDIVKKWRDYRVRIWKDQVLKNKHIPKPLSAQAFRAACITAKPE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019558 [exp]	0	1
					Lus10014737 [exp]	2.8	1.0000
					Lus10012677 [exp]	3.2	0.9903
AT1G04520		PDLP2	plasmodesmata-located protein ...		Lus10028049 [exp]	4.0	1.0000
AT3G04060	NAC	ANAC046	NAC domain containing protein ...		Lus10033699 [exp]	4.9	1.0000
AT4G16195			Plant self-incompatibility pro...		Lus10019768 [exp]	5.7	1.0000
					Lus10021773 [exp]	6.3	1.0000
AT3G51560			Disease resistance protein (TI...		Lus10029858 [exp]	6.6	0.9780
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10024816 [exp]	6.9	0.9609
AT4G27170		SESA4, AT2S4	seed storage albumin 4 (.1)		Lus10040395 [exp]	6.9	1.0000
					Lus10039552 [exp]	7.5	1.0000

Compare expression of checked genes

Lus10019558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.