Lus10019560 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019560 pacid=23169916 polypeptide=Lus10019560 locus=Lus10019560.g ID=Lus10019560.BGIv1.0 annot-version=v1.0
ATGACAAACGTGATTGTTGTTGTTGTCAACGGAGTTCTGGTACTCCCAACAAGTGAGAAGAACGATCAGATTAGTAACAGAGCACAAACAAAGATTCTAG
GCTCTGGCTCTAGATCCGTCGTCGATTCAAGCCTTGGAGACCATAGCTTCTCTTCTGGAAACAATCCGGTGCTCTACAACTTGATCCTTCGGGACTGGAA
GCTTTCCGAGACGGCGTTGTTGCGGATCAGTAAGGAGAGGAGGAAGCTTCAAGCCTATGGTGTTGCAGATCGAAGAATTGAGAGAGTGGAGGAGGAGAGG
ATTGGCCGTGGCGACGAAGGAAGCATGTGGTGTTGCAGATCGAAGAATCGAGAGAGTGGAGGAGGAGAGGAGCGCTTGCGGTGA
AA sequence
>Lus10019560 pacid=23169916 polypeptide=Lus10019560 locus=Lus10019560.g ID=Lus10019560.BGIv1.0 annot-version=v1.0
MTNVIVVVVNGVLVLPTSEKNDQISNRAQTKILGSGSRSVVDSSLGDHSFSSGNNPVLYNLILRDWKLSETALLRISKERRKLQAYGVADRRIERVEEER
IGRGDEGSMWCCRSKNRESGGGEERLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019560 0 1
Lus10032858 15.9 0.7908
AT4G13340 LRX3 leucine-rich repeat/extensin 3... Lus10037905 17.5 0.7502
AT5G06130 chaperone protein dnaJ-related... Lus10016993 23.9 0.7399
Lus10021668 25.2 0.7850
AT4G36980 unknown protein Lus10009350 35.9 0.7742
AT4G39010 ATGH9B18 glycosyl hydrolase 9B18 (.1) Lus10018077 50.7 0.6869
Lus10023010 57.4 0.7571
Lus10017572 89.3 0.7375
AT4G37640 ACA2 calcium ATPase 2 (.1) Lus10002458 103.3 0.7057
AT4G19890 Pentatricopeptide repeat (PPR-... Lus10000428 106.7 0.7242

Lus10019560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.