Lus10019564 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019564 pacid=23169924 polypeptide=Lus10019564 locus=Lus10019564.g ID=Lus10019564.BGIv1.0 annot-version=v1.0
ATGGCCGTCATCGATGTTATGGGGTACTTTGAGGAGGAAAGCTGCATTGAGAGGATCAGCCCTTGTGACCTCGACACACGCCCTGGCTTCCTTTGTCCAC
CTTGTGCCATGGATACCAAGAGAGGAGGAAGTTATAAGGGAGGGAAAGTAAGCTTTGAGAATCTTCTTGACATTTTCTCTGGATCTCTGCTTCCACGGGA
TATCAAGGACATGGGTGCAAAGCATGATATTTTTGAAAGAAACCTCATCGGTGGTTCCCAGGCCATCCTAAGGCTTTAA
AA sequence
>Lus10019564 pacid=23169924 polypeptide=Lus10019564 locus=Lus10019564.g ID=Lus10019564.BGIv1.0 annot-version=v1.0
MAVIDVMGYFEEESCIERISPCDLDTRPGFLCPPCAMDTKRGGSYKGGKVSFENLLDIFSGSLLPRDIKDMGAKHDIFERNLIGGSQAILRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019564 0 1
Lus10002411 1.4 0.9992
AT5G13825 unknown protein Lus10000042 2.0 0.9980
AT2G16460 Protein of unknown function (D... Lus10041812 3.5 0.9812
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10002774 4.2 0.9838
Lus10010397 5.5 0.9731
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Lus10031007 5.9 0.9771
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Lus10020687 9.2 0.9251
AT5G66780 unknown protein Lus10024013 9.3 0.9248
Lus10040023 10.3 0.8736
Lus10034388 15.7 0.9304

Lus10019564 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.