Plant FIBer expression Database

Lus10019568 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24490 37 / 0.0005 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014730
[exp]
65 / 3e-15 AT3G24490 49 / 4e-08 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Lus10019388
[exp]
56 / 1e-10 AT3G24490 200 / 2e-60 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Lus10017725
[exp]
42 / 1e-05 AT3G24490 243 / 1e-77 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Lus10033094
[exp]
42 / 1e-05 AT3G24490 238 / 6e-76 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G075500
[exp]
39 / 0.0001 AT3G24490 252 / 1e-81 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
PFAM info
Representative CDS sequence
>Lus10019568 pacid=23169905 polypeptide=Lus10019568 locus=Lus10019568.g ID=Lus10019568.BGIv1.0 annot-version=v1.0
ATGACGAGTACTAAGAAGGAACAGATGTTAGAGTTGGAGATGATGCGGGTTGATTTCCGGGCGAGATTGGAGTTGCAGAGGAAGCAAATCTTGGAGATAG
CTCTGGCCGAGATTGCTAAAATCAGAGATGAGGATGATGTTGATGATGATAATGACCCTGAAAGCAATGCCAATAAAGAAAGAAAAGCTGAGGATGAAAG
TGGTGATGATGATTATTCTGGGGAATGTCAGCTAACAATGTGA
AA sequence
>Lus10019568 pacid=23169905 polypeptide=Lus10019568 locus=Lus10019568.g ID=Lus10019568.BGIv1.0 annot-version=v1.0
MTSTKKEQMLELEMMRVDFRARLELQRKQILEIALAEIAKIRDEDDVDDDNDPESNANKERKAEDESGDDDYSGECQLTM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24490 Trihelix Alcohol dehydrogenase transcri... Lus10019568
[exp]
0 1
AT1G07530 GRAS SCL14, ATGRAS2 GRAS \(GAI, RGA, SCR\) 2, ARAB... Lus10016519
[exp]
5.1 0.8071
AT5G39960 GTP binding;GTP binding (.1) Lus10033794
[exp]
7.7 0.7999
AT3G07720 Galactose oxidase/kelch repeat... Lus10012345
[exp]
8.2 0.8006
AT5G16080 ATCXE17 carboxyesterase 17 (.1) Lus10041632
[exp]
11.2 0.7897
AT3G03980 NAD(P)-binding Rossmann-fold s... Lus10002628
[exp]
12.8 0.7928
AT1G44750 ATPUP11 purine permease 11 (.1.2.3) Lus10012606
[exp]
15.3 0.7621
AT5G55640 unknown protein Lus10043162
[exp]
23.2 0.7327
Lus10039878
[exp]
24.0 0.7579
AT1G65660 SMP1 SWELLMAP 1, Pre-mRNA splicing ... Lus10007479
[exp]
27.6 0.7463
AT1G13950 EIF5A, ATELF5A-... eukaryotic elongation factor 5... Lus10026637
[exp]
27.6 0.7512

Lus10019568 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.