Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19810 68 / 1e-14 ChiC class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19820 67 / 2e-14 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19800 53 / 2e-09 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19760 47 / 3e-07 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19720 46 / 7e-07 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19730 42 / 2e-05 Glycosyl hydrolase superfamily protein (.1) AT4G19750 41 / 2e-05 Glycosyl hydrolase family protein with chitinase insertion domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040021 [exp] 108 / 7e-29 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10019061 [exp] 74 / 9e-17 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10032626 [exp] 69 / 2e-15 AT4G19810 105 / 3e-27 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036315 [exp] 62 / 1e-12 AT4G19820 253 / 3e-81 Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10019060 [exp] 55 / 5e-10 AT4G19810 437 / 1e-149 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036310 [exp] 54 / 8e-10 AT4G19810 277 / 3e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10024081 [exp] 51 / 1e-08 AT1G61500 333 / 5e-102 S-locus lectin protein kinase family protein (.1) Lus10036311 [exp] 50 / 2e-08 AT4G19810 377 / 5e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10041639 [exp] 50 / 2e-08 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111900 [exp] 74 / 1e-16 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.018G111600 [exp] 67 / 3e-14 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.006G188400 [exp] 61 / 4e-12 AT4G19810 477 / 2e-169 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G188300 [exp] 60 / 7e-12 AT4G19810 379 / 2e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G111700 [exp] 58 / 3e-11 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111800 [exp] 58 / 4e-11 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G112000 [exp] 38 / 0.0004 AT4G19810 284 / 3e-93 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112100 [exp] 38 / 0.0004 AT4G19810 279 / 3e-91 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00704 [flax] [poplar] Glyco_hydro_18 Glycosyl hydrolases family 18
Representative CDS sequence Show only first row Show all	>Lus10019601 pacid=23142569 polypeptide=Lus10019601 locus=Lus10019601.g ID=Lus10019601.BGIv1.0 annot-version=v1.0 ATGGCTACAATCAAACTATTGTTATGTTTATTCTTCTTCTTAATTCCATGCTTCAACATACATATCTGCACCGCACAACTTATAAAATCCGGCTACTGGT ATCACGACAGCGAAATCCCAATCTCCGACATTGACTCAACACTCTTCACTCACCTCATCTGCGCATTCTCCTCCCTTAATTCCACCACTTCTAACCTTTC CTTCCCTCCCGGTTCCATCCCCAATTTCTCCAACTTCGCCGCCACTGTCCGCCACCGCAACCCCACCGTCGTCAACTTACTCTCTGTCTGGAATGGCTAG
AA sequence Show only first row Show all	>Lus10019601 pacid=23142569 polypeptide=Lus10019601 locus=Lus10019601.g ID=Lus10019601.BGIv1.0 annot-version=v1.0 MATIKLLLCLFFFLIPCFNIHICTAQLIKSGYWYHDSEIPISDIDSTLFTHLICAFSSLNSTTSNLSFPPGSIPNFSNFAATVRHRNPTVVNLLSVWNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Lus10019601 [exp]	0	1
AT5G44080	bZIP		Basic-leucine zipper (bZIP) tr...		Lus10018857 [exp]	11.5	0.8937
AT1G73670		ATMPK15	MAP kinase 15 (.1)		Lus10034601 [exp]	12.8	0.8797
AT4G10970			unknown protein		Lus10023075 [exp]	23.2	0.8801
AT1G73670		ATMPK15	MAP kinase 15 (.1)		Lus10021784 [exp]	24.7	0.8780
AT5G12230		MED19A	unknown protein		Lus10028832 [exp]	32.4	0.8714
AT1G80170			Pectin lyase-like superfamily ...		Lus10026798 [exp]	33.7	0.8758
AT2G30105			unknown protein		Lus10031291 [exp]	37.3	0.8763
AT5G02520			unknown protein		Lus10025814 [exp]	52.8	0.8560
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10035196 [exp]	54.6	0.8629
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10042725 [exp]	57.0	0.8615

Compare expression of checked genes

Lus10019601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.