Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G50740 177 / 6e-59 Transmembrane proteins 14C (.1) AT3G20510 175 / 4e-58 Transmembrane proteins 14C (.1) AT3G57280 79 / 6e-19 Transmembrane proteins 14C (.1) AT2G26240 63 / 6e-14 Transmembrane proteins 14C (.1) AT3G43520 55 / 6e-10 Transmembrane proteins 14C (.1) AT2G38550 42 / 4e-05 Transmembrane proteins 14C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008541 [exp] 234 / 1e-81 AT1G50740 178 / 3e-59 Transmembrane proteins 14C (.1) Lus10035434 [exp] 68 / 3e-14 AT2G43080 365 / 4e-125 P4H isoform 1 (.1) Lus10031047 [exp] 49 / 9e-08 AT3G57280 132 / 6e-37 Transmembrane proteins 14C (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G424000 [exp] 198 / 3e-67 AT1G50740 158 / 2e-51 Transmembrane proteins 14C (.1) Potri.011G138100 [exp] 176 / 3e-58 AT1G50740 128 / 1e-39 Transmembrane proteins 14C (.1) Potri.003G094300 [exp] 80 / 2e-19 AT3G57280 214 / 3e-70 Transmembrane proteins 14C (.1) Potri.001G139800 [exp] 77 / 3e-18 AT3G57280 172 / 5e-54 Transmembrane proteins 14C (.1) Potri.006G108700 [exp] 59 / 2e-11 AT2G38550 275 / 7e-91 Transmembrane proteins 14C (.1) Potri.016G137200 [exp] 56 / 4e-10 AT2G38550 263 / 4e-86 Transmembrane proteins 14C (.1) Potri.006G217400 [exp] 50 / 4e-08 AT3G43520 161 / 7e-49 Transmembrane proteins 14C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03647 [flax] [poplar] Tmemb_14 Transmembrane proteins 14C
Representative CDS sequence Show only first row Show all	>Lus10019624 pacid=23142566 polypeptide=Lus10019624 locus=Lus10019624.g ID=Lus10019624.BGIv1.0 annot-version=v1.0 ATGCACGATTTCTGCTTCACGATCCCGTACGGGCTGATTCTAGTGGCTGGGGGAGTAATTGGGTTTCTGAAGAAAGGGAGCGTCACATCCCTCGGTGGCG GCGTTGGAGCTGGATTTCTACTTATCCTAGCTGGCTATTTGAGTCTTAAGGCTTTCCAGAAGAGAAAGAACAATTACTTCGCTTTAGCCATCGAAACAGT TTGTGCCGCTGCTCTCACATTCCTTATGGGGCAACGTTACATTCAGACCTCCAAAATTATGCCTGCTGGTCTTGTCGCTGCTATCAGTGGTCTCATGACT GTATTTTATCTGTACAAAGTTGCCACCGGTGGCAACCACATTCCAAGCAAGGCTGAGTGA
AA sequence Show only first row Show all	>Lus10019624 pacid=23142566 polypeptide=Lus10019624 locus=Lus10019624.g ID=Lus10019624.BGIv1.0 annot-version=v1.0 MHDFCFTIPYGLILVAGGVIGFLKKGSVTSLGGGVGAGFLLILAGYLSLKAFQKRKNNYFALAIETVCAAALTFLMGQRYIQTSKIMPAGLVAAISGLMT VFYLYKVATGGNHIPSKAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G50740			Transmembrane proteins 14C (.1...		Lus10019624 [exp]	0	1
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10040307 [exp]	1.7	0.8743
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10034442 [exp]	2.0	0.8334
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10016624 [exp]	3.5	0.8385
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10023428 [exp]	3.7	0.8637
AT5G61310			Cytochrome c oxidase subunit V...		Lus10001454 [exp]	4.9	0.8225
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10003023 [exp]	5.0	0.8277
AT5G61310			Cytochrome c oxidase subunit V...		Lus10025028 [exp]	9.0	0.8116
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Lus10006328 [exp]	12.2	0.7540
AT5G67490			unknown protein		Lus10000389 [exp]	12.8	0.7971
AT4G16444			unknown protein		Lus10016696 [exp]	15.4	0.7294

Compare expression of checked genes

Lus10019624 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.