Lus10019634 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66860 254 / 1e-85 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1)
AT4G23620 127 / 1e-35 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009338 388 / 4e-138 AT5G66860 297 / 4e-102 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1)
Lus10000590 113 / 5e-30 AT4G23620 329 / 2e-114 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1.2)
Lus10011005 110 / 5e-29 AT4G23620 328 / 4e-114 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G135000 298 / 1e-102 AT5G66860 320 / 5e-111 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1)
Potri.007G039700 295 / 3e-101 AT5G66860 315 / 4e-109 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1)
Potri.001G097801 122 / 8e-34 AT4G23620 320 / 4e-111 Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain (.1.2)
PFAM info
Representative CDS sequence
>Lus10019634 pacid=23139253 polypeptide=Lus10019634 locus=Lus10019634.g ID=Lus10019634.BGIv1.0 annot-version=v1.0
ATGGCACAGTATTGGCGCGGACTTAAAACGGCAGCGAAATTCACTCCGTCTCCGCCATCCCCTCTCTACTCCCAGTCCCAGTACTATCTATACCACACGA
TCCAGGCGATCCCTCGTGAAGCCACCGGAAGCCGAGTCGCGGATCGAGACAGAGCTCAAGGTAGGATTCCGGCCGTGGTTTTCTCCCAGAGCATCCTCGA
TAAGAGCCCTAACTCTCGTTCCTCGTCGAGGAAGCGGCTGCTGACTACGGAGAAGAAGCAGATTCTGTCCATCTTGAAGTCACTCGATTCTCCCTATTTC
TGCTCCACCACGTTTCCGCTCCAGATTCGGGCTGGATCCGGGTCATCCGTGTTGCTCGAGTCCGGGAACGTCCTTCCTGTTAAGGTACATAGAGATAAAG
AGACTGGAAAGATTATGAATTTGGTATTTGTTTGGGCTGATCCAGGCACTGAATTGAAAGTTGACGTGCCGGTTGTTTTCAAAGGAGAAGAGAATTGCCC
TGGTCTACTGAAAGGTGGCCGGTTGAACCGTTTAAGAGACACCCTCAAGCTACTATGCCGTGCTGAAAACATCCCTCAAAAGATTGAGGTGGACCTGAGC
AACCTAGACACCGGGGAGAGAGTATCGGTGCGTGATGTCAATATCGACCCCACACTAAAGCTTCTAACCAAGGACGAGTCCCTCCCTGTATGTAAGGTCG
TTTCAACAAACTCGAAAGCATCAGACCCTGTTTCGGTATAG
AA sequence
>Lus10019634 pacid=23139253 polypeptide=Lus10019634 locus=Lus10019634.g ID=Lus10019634.BGIv1.0 annot-version=v1.0
MAQYWRGLKTAAKFTPSPPSPLYSQSQYYLYHTIQAIPREATGSRVADRDRAQGRIPAVVFSQSILDKSPNSRSSSRKRLLTTEKKQILSILKSLDSPYF
CSTTFPLQIRAGSGSSVLLESGNVLPVKVHRDKETGKIMNLVFVWADPGTELKVDVPVVFKGEENCPGLLKGGRLNRLRDTLKLLCRAENIPQKIEVDLS
NLDTGERVSVRDVNIDPTLKLLTKDESLPVCKVVSTNSKASDPVSV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66860 Ribosomal protein L25/Gln-tRNA... Lus10019634 0 1
AT3G59820 LETM1-like protein (.1.2) Lus10025602 1.4 0.9409
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10030113 4.8 0.9502
AT2G43650 EMB2777 EMBRYO DEFECTIVE 2777, Sas10/U... Lus10027922 8.5 0.9237
AT3G21110 PUR7, ATPURC PURIN C, purin 7 (.1.2) Lus10025652 9.2 0.9067
AT4G32720 ATLA1 La protein 1 (.1.2) Lus10011685 9.2 0.9361
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023454 13.4 0.9368
AT2G35040 AICARFT/IMPCHase bienzyme fami... Lus10013871 15.5 0.9350
AT2G26830 EMB1187 embryo defective 1187, Protein... Lus10019424 15.7 0.9041
AT1G77030 hydrolases, acting on acid anh... Lus10018941 16.1 0.9275
AT3G04600 Nucleotidylyl transferase supe... Lus10026754 16.5 0.9309

Lus10019634 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.