Lus10019656 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G37090 105 / 1e-28 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000742 302 / 3e-104 AT4G37090 116 / 2e-31 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G034600 181 / 2e-58 AT4G37090 106 / 4e-29 unknown protein
PFAM info
Representative CDS sequence
>Lus10019656 pacid=23139282 polypeptide=Lus10019656 locus=Lus10019656.g ID=Lus10019656.BGIv1.0 annot-version=v1.0
ATGTCGGCCAGAGATGAATCGGATTCCGACGCACCGGAGGAGTTCACCGCCGATCAGGGAATCGAATTAGATGCGGAGATAAGGAAGATTCAGAAGGAGA
ACAAGTCAAGAATTACTCGTGAGGGTAAAGAACGGCGAAGGAAATGGGCAGAGAGGAAGACGCCACGATCATCCAAAAAGGAAGACAAAGAAGAAGTCAA
AGAAGCTATCGAAACTGAAGAGGAAGACGAAGAGTCTGCAAGTTCCAAAGGGATGCTTCCAAACAACATTGTTCAACTACTAGCTGCTCGTGAGAAGAAA
GTGTTTTCTGCAAAGTCTGATGATGATGATGATGAGAAGACTGGCTCAGGTGCAAAGCTTCCCACAAGGAAGAAGAAGAAGGCGAGAGGCTCCGGGCCAC
ATACTGTTATTTTGAACGAGGTATCCCCGCCACCTTGTTTACAGAACGCGTTAGAGTTCCTGAAGGAGAACAAAATGCGGGTTGCAAGATCGTCAGCTGT
TCTCAACAACTCCAACCAAGCTCTCCGCCTTATATCCGCTTCTGGCTTGTTGAGTAAGAACTGA
AA sequence
>Lus10019656 pacid=23139282 polypeptide=Lus10019656 locus=Lus10019656.g ID=Lus10019656.BGIv1.0 annot-version=v1.0
MSARDESDSDAPEEFTADQGIELDAEIRKIQKENKSRITREGKERRRKWAERKTPRSSKKEDKEEVKEAIETEEEDEESASSKGMLPNNIVQLLAAREKK
VFSAKSDDDDDEKTGSGAKLPTRKKKKARGSGPHTVILNEVSPPPCLQNALEFLKENKMRVARSSAVLNNSNQALRLISASGLLSKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G37090 unknown protein Lus10019656 0 1
AT4G15930 Dynein light chain type 1 fami... Lus10037494 1.4 0.8805
AT4G15930 Dynein light chain type 1 fami... Lus10006500 4.9 0.8063
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10039485 5.8 0.8262
Lus10000961 7.7 0.7751
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Lus10043297 8.3 0.8084
AT5G12190 RNA-binding (RRM/RBD/RNP motif... Lus10026814 8.4 0.7960
AT2G34510 Protein of unknown function, D... Lus10038495 10.7 0.8049
AT5G50240 PIMT2, AtPIMT2 Arabidopsis thaliana protein-l... Lus10033049 13.1 0.7658
AT4G23630 RTNLB1, BTI1 Reticulan like protein B1, VIR... Lus10032313 13.2 0.8003
AT1G07090 LSH6 LIGHT SENSITIVE HYPOCOTYLS 6, ... Lus10022023 21.9 0.7888

Lus10019656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.