Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 184 / 1e-60 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 178 / 3e-58 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 171 / 2e-55 Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 167 / 5e-54 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G66110 152 / 5e-48 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 149 / 1e-46 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G35060 141 / 1e-43 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 107 / 6e-30 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 101 / 5e-28 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016436 [exp] 320 / 2e-114 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 245 / 1e-84 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 225 / 1e-76 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10039419 [exp] 190 / 1e-62 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 185 / 7e-61 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 183 / 5e-60 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 182 / 1e-59 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10019789 [exp] 173 / 3e-56 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 172 / 5e-56 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G087300 [exp] 244 / 2e-84 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 232 / 1e-79 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 194 / 1e-64 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 192 / 8e-64 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 192 / 1e-63 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 181 / 2e-59 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 170 / 4e-55 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.009G135300 [exp] 167 / 1e-53 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.004G175400 [exp] 165 / 6e-53 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 151 / 2e-47 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10019676 pacid=23139208 polypeptide=Lus10019676 locus=Lus10019676.g ID=Lus10019676.BGIv1.0 annot-version=v1.0 ATGGGGATTGCAGGAACTTTGGAGTACTTGTCTGAGTTGATGGCAAGCTCTGGCCATAAACACAAGAAGAGGAAGCAATTGCAGACTGTGGAGCTCAAGG TCAGGATGGATTGTGATGGTTGTGAGCTCAAGGTCAAGAATTCACTTTCCTCTCTAAGTGGGGTGAAGAGTGTGGAGATAAACAGGAAGCAACAGAAGGT GACAGTAACCGGGTTCGTCGAGCCACACAAAGTGCTGAAGAAGGCGAAATCGACAGGGAAAAGAGCGGAGATTTGGCCATACGTTCCATATAACTTGGTG GCTCAGCCATACATTGCTGGAACTTATGACAAGAAAGCACCTCCTGGCTATGTCAGGAAAGCTGAGCAAACCGGTGTTTCTAGCGGAACCTTAGTTATAA ACAGAGGAGGAGACCCTTACACTTCCATGTTCAGTGATGACAACCCTAATGCTTGCTCCGTCATGTAA
AA sequence Show only first row Show all	>Lus10019676 pacid=23139208 polypeptide=Lus10019676 locus=Lus10019676.g ID=Lus10019676.BGIv1.0 annot-version=v1.0 MGIAGTLEYLSELMASSGHKHKKRKQLQTVELKVRMDCDGCELKVKNSLSSLSGVKSVEINRKQQKVTVTGFVEPHKVLKKAKSTGKRAEIWPYVPYNLV AQPYIAGTYDKKAPPGYVRKAEQTGVSSGTLVINRGGDPYTSMFSDDNPNACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39700			Heavy metal transport/detoxifi...		Lus10019676 [exp]	0	1
					Lus10022162 [exp]	9.9	0.6204
AT5G16910		ATCSLD2	cellulose-synthase like D2 (.1...		Lus10012119 [exp]	10.2	0.5829
AT2G48140		EDA4	embryo sac development arrest ...		Lus10042613 [exp]	14.9	0.6082
					Lus10007414 [exp]	25.3	0.5797
AT2G43590			Chitinase family protein (.1)		Lus10003227 [exp]	52.4	0.5897
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10023106 [exp]	53.9	0.5447
AT5G58660			2-oxoglutarate (2OG) and Fe(II...		Lus10031865 [exp]	72.5	0.5305
					Lus10033059 [exp]	73.0	0.5305
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	73.5	0.5305
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	74.0	0.5305

Compare expression of checked genes

Lus10019676 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.