Lus10019689 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22070 243 / 3e-77 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G39680 178 / 3e-53 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G02010 172 / 1e-50 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33170 170 / 9e-50 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 166 / 8e-49 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G09950 166 / 3e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G57430 165 / 4e-48 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G52630 162 / 8e-48 MEF1 mitochondrial RNAediting factor 1 (.1)
AT1G25360 163 / 2e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G13650 163 / 3e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016425 293 / 6e-96 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10040577 184 / 7e-58 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10001483 172 / 7e-51 AT5G39680 691 / 0.0 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020588 163 / 1e-50 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031994 170 / 9e-50 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030908 169 / 2e-49 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10022629 167 / 2e-49 AT2G41080 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018978 169 / 3e-49 AT4G13650 1258 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035157 155 / 3e-49 AT3G26782 221 / 2e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G085500 254 / 3e-81 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.006G001200 179 / 5e-54 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G027800 177 / 1e-52 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G053500 175 / 2e-52 AT5G52630 785 / 0.0 mitochondrial RNAediting factor 1 (.1)
Potri.001G075800 177 / 3e-52 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G084900 175 / 4e-52 AT5G39680 782 / 0.0 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G322100 173 / 2e-51 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G091600 171 / 7e-51 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G075000 171 / 1e-50 AT2G41080 755 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 171 / 6e-50 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10019689 pacid=23139190 polypeptide=Lus10019689 locus=Lus10019689.g ID=Lus10019689.BGIv1.0 annot-version=v1.0
ATGAAGGATAGAGGAGTTAAGAAAGAGCAAGGTTCCAGCTGGGTTCAGATTAAGAACAGGGTTCATGTGTTTGGTGCTGAAGATGGGGTGCATCCTGAGA
GAGAGGAGATATATAAGAAGATGGATGAGATATGGGACGAGATAAAAAGAATGGGGTTCGTCCCGGATTCTGCATCGGTACTGCATGATCTTGAGATGGA
GGTTAAGGATCGGATTCTGAGGTATCACAGTGAGAAGCTTGCTATTGCATTTGGACTGATAAGTACGCCGGAGAAGACGACTCTCAGGATAATGAAGAAT
CTCAGAATCTGTAACGACTGTCACACTGCTGTCAAGTATATCTCCAAGCTTGTGAGTAGGGAAATTGTTGTTAGAGATGCTACCCGCATCCACCATTTTA
AAGATGGTCCCTGTTCTTGTATGAACTACTGGTAA
AA sequence
>Lus10019689 pacid=23139190 polypeptide=Lus10019689 locus=Lus10019689.g ID=Lus10019689.BGIv1.0 annot-version=v1.0
MKDRGVKKEQGSSWVQIKNRVHVFGAEDGVHPEREEIYKKMDEIWDEIKRMGFVPDSASVLHDLEMEVKDRILRYHSEKLAIAFGLISTPEKTTLRIMKN
LRICNDCHTAVKYISKLVSREIVVRDATRIHHFKDGPCSCMNYW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G22070 pentatricopeptide (PPR) repeat... Lus10019689 0 1
AT3G05140 RBK2 ROP binding protein kinases 2 ... Lus10018959 1.0 0.7173
AT1G48120 hydrolases;protein serine/thre... Lus10008255 13.1 0.6926
AT2G15220 Plant basic secretory protein ... Lus10019802 14.1 0.6916
AT4G37850 bHLH bHLH025 basic helix-loop-helix (bHLH) ... Lus10009726 15.5 0.6736
Lus10027005 19.4 0.7035
Lus10005514 21.0 0.6425
AT1G61320 FBD / Leucine Rich Repeat doma... Lus10010664 22.1 0.6425
AT5G12060 Plant self-incompatibility pro... Lus10030964 23.2 0.6425
AT2G04865 Aminotransferase-like, plant m... Lus10014633 24.2 0.6425
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10017015 25.2 0.6425

Lus10019689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.