Lus10019692 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05370 81 / 1e-18 AtRLP31 receptor like protein 31 (.1)
AT3G05360 77 / 3e-17 AtRLP30 receptor like protein 30 (.1)
AT4G13820 74 / 3e-16 Leucine-rich repeat (LRR) family protein (.1)
AT1G45616 74 / 6e-16 AtRLP6 receptor like protein 6 (.1)
AT4G13920 73 / 8e-16 AtRLP50 receptor like protein 50 (.1)
AT2G34930 73 / 1e-15 disease resistance family protein / LRR family protein (.1)
AT1G71390 73 / 1e-15 AtRLP11 receptor like protein 11 (.1)
AT1G47890 72 / 3e-15 AtRLP7 receptor like protein 7 (.1)
AT4G13880 71 / 5e-15 AtRLP48 receptor like protein 48 (.1)
AT3G23120 71 / 8e-15 AtRLP38 receptor like protein 38 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016401 191 / 1e-61 AT1G71390 87 / 6e-19 receptor like protein 11 (.1)
Lus10006824 167 / 6e-50 AT3G23110 185 / 2e-50 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
Lus10042239 161 / 1e-46 AT1G45616 395 / 1e-121 receptor like protein 6 (.1)
Lus10004310 156 / 8e-45 AT2G33060 358 / 6e-111 receptor like protein 27 (.1)
Lus10004313 152 / 2e-43 AT2G33060 335 / 5e-103 receptor like protein 27 (.1)
Lus10026415 140 / 4e-39 AT1G47890 424 / 3e-131 receptor like protein 7 (.1)
Lus10009330 135 / 1e-37 AT1G71400 245 / 2e-69 receptor like protein 12 (.1)
Lus10003389 135 / 1e-37 AT1G45616 432 / 7e-135 receptor like protein 6 (.1)
Lus10006825 130 / 7e-36 AT1G47890 377 / 6e-114 receptor like protein 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G120466 125 / 3e-37 AT1G47890 73 / 4e-15 receptor like protein 7 (.1)
Potri.016G120600 132 / 3e-36 AT1G47890 441 / 7e-137 receptor like protein 7 (.1)
Potri.001G128400 96 / 8e-24 AT1G45616 498 / 2e-159 receptor like protein 6 (.1)
Potri.016G126900 90 / 1e-21 AT1G45616 510 / 5e-165 receptor like protein 6 (.1)
Potri.016G127101 87 / 2e-20 AT1G47890 580 / 0.0 receptor like protein 7 (.1)
Potri.016G127000 84 / 1e-19 AT1G47890 588 / 0.0 receptor like protein 7 (.1)
Potri.011G055000 83 / 3e-19 AT1G45616 456 / 3e-145 receptor like protein 6 (.1)
Potri.001G389100 82 / 5e-19 AT5G27060 468 / 1e-149 receptor like protein 53 (.1)
Potri.012G026900 82 / 6e-19 AT3G25010 315 / 2e-93 receptor like protein 41 (.1)
Potri.012G013435 82 / 8e-19 AT3G11080 367 / 6e-112 receptor like protein 35 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
CL0022 PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence
>Lus10019692 pacid=23139187 polypeptide=Lus10019692 locus=Lus10019692.g ID=Lus10019692.BGIv1.0 annot-version=v1.0
ATGGTTGATATCGTTATTGGTACCTCTTCTTCCCATACTAATGGGCAGCAGAAGTGCTCTGGCCGATGCCTGGAAGACCAGCGATCCTTGCTGCTCCAGT
TCAAACATAGCCTCACTTTCGACCAATCATTATCAGGAAAGCTGGCAAGGTGGAATGCAAGCGCTGACTGTTGCCAGTGGCCTGGCATAAGTTGTGATCC
CGGTGGCCTCGGTCACGTTACCGGCCTCAACTTGAGCGATGGATACATCACCGGAGGCGGAGGACTAGACACCTCCTCAGCTCTCTTCAGTCTTCGGCAC
CTTGAGGACCTGAATTTGTCCGGAAACTACTTCAATACCAATTTTCCGGCTGCACTTGCCAACCTCACCAATTTGAGGTATCTGGACTTATCTTATGCTG
GCTTCTCCGGGCAATGCCCGCTTCCATCTCTCAGTTGA
AA sequence
>Lus10019692 pacid=23139187 polypeptide=Lus10019692 locus=Lus10019692.g ID=Lus10019692.BGIv1.0 annot-version=v1.0
MVDIVIGTSSSHTNGQQKCSGRCLEDQRSLLLQFKHSLTFDQSLSGKLARWNASADCCQWPGISCDPGGLGHVTGLNLSDGYITGGGGLDTSSALFSLRH
LEDLNLSGNYFNTNFPAALANLTNLRYLDLSYAGFSGQCPLPSLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05370 AtRLP31 receptor like protein 31 (.1) Lus10019692 0 1
Lus10033476 1.4 0.9284
AT5G10250 DOT3 DEFECTIVELY ORGANIZED TRIBUTAR... Lus10026046 3.2 0.8884
AT5G02130 NDP1 Tetratricopeptide repeat (TPR)... Lus10023783 3.7 0.8648
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031176 4.2 0.8839
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10020877 4.5 0.8708
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031175 5.5 0.8700
AT2G34090 MEE18 maternal effect embryo arrest ... Lus10000989 6.6 0.8818
AT4G21510 F-box family protein (.1) Lus10022370 8.4 0.8434
AT1G09030 CCAAT NF-YB4 "nuclear factor Y, subunit B4"... Lus10004493 8.7 0.7940
Lus10020900 8.8 0.8394

Lus10019692 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.