Lus10019697 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38420 182 / 4e-54 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 134 / 1e-35 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G05670 129 / 1e-33 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT4G11690 123 / 8e-32 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G01110 123 / 2e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62680 122 / 2e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22470 122 / 3e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G64580 121 / 3e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G06580 120 / 5e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63330 118 / 5e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001256 469 / 2e-165 AT2G38420 403 / 8e-137 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10002476 461 / 5e-163 AT2G38420 363 / 4e-122 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036020 132 / 2e-34 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038974 129 / 2e-33 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027267 127 / 1e-32 AT1G74580 813 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013283 126 / 2e-32 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10003424 117 / 3e-29 AT4G31850 1373 / 0.0 proton gradient regulation 3 (.1)
Lus10016727 116 / 4e-29 AT5G61990 345 / 2e-108 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10023863 115 / 1e-28 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G106400 256 / 2e-82 AT2G38420 428 / 1e-146 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G046000 131 / 3e-34 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G047000 129 / 1e-33 AT3G04760 781 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.002G109500 127 / 5e-33 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G046100 127 / 5e-33 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050500 126 / 1e-32 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G014500 126 / 2e-32 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.010G035700 125 / 2e-32 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.018G038300 125 / 2e-32 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.010G234500 125 / 3e-32 AT1G74580 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10019697 pacid=23139303 polypeptide=Lus10019697 locus=Lus10019697.g ID=Lus10019697.BGIv1.0 annot-version=v1.0
ATGTTTTTAGTGCCAAATGTAATTGGATTCTTCGGGGAACTGAGAAAGCTAGGACTTGTTCCAGGGTTGATATATTACACCAATCTCATTAGGTTCTTGG
TTAGAGAAGGAGACGGAGTTGAAGCTATGAATCTTCTGAATCAGGTGAAATCAGACGGGATCAAGCCTGATATAGTCTGCTACAACTTGGTTCTGAAAGG
GTTAATCTTCATCCAGGAGTTTGAATTAGCAGATAACCTTTTTGACGAATTGCTTCTGTACGGATTGGTGCCTGATATTCGTACTTACAATATCTACATA
GACGGATTGTGCAAGCAAGCCAAGATGGAAAGTGGAATCAAGATGGTTGAACCAATGCAGCAACTGGGATGCAAGCCTGATGTCAACACTTACAATACAT
TAGTAGCTGCACTGAATAAAGATGGAAACTTTGGTGGTGCAAGGGAGCTGGTGAGGGAGATGGCCAAGAAGGGAATCAGATGGAATATAGAGACGTATGA
GATTGTGATCGATCTGTTGAGTAGGTGTGGAGAAATGGCTAAAGCTTATGCTTTGGTGGAGGAAGGATTGCAGAAAGAGCTGGTGGGTGATGTTGTGGCT
GCTGAGAATGTGGTTTGTGGGTTGTGTAGAAGGGGAATGATGGATAATGCTGTGGGATTGATTGTTAAAATGGTGGAGAGGAATGTTGCTCCTGGAGCTG
GAGCTTGGGAAGCGGTTCTTTTGGGGTTGGGGTTCAAGGTTGAATGTTCAGGAACTAGGTTTGGTGGATTGTTGCTGGATTTGCAAAGTGTAGACACAGT
TCAGTATGAGAGATTGATCCAAATTTGTATTCACATAAAAAGAATGGTAGTTAGTTAA
AA sequence
>Lus10019697 pacid=23139303 polypeptide=Lus10019697 locus=Lus10019697.g ID=Lus10019697.BGIv1.0 annot-version=v1.0
MFLVPNVIGFFGELRKLGLVPGLIYYTNLIRFLVREGDGVEAMNLLNQVKSDGIKPDIVCYNLVLKGLIFIQEFELADNLFDELLLYGLVPDIRTYNIYI
DGLCKQAKMESGIKMVEPMQQLGCKPDVNTYNTLVAALNKDGNFGGARELVREMAKKGIRWNIETYEIVIDLLSRCGEMAKAYALVEEGLQKELVGDVVA
AENVVCGLCRRGMMDNAVGLIVKMVERNVAPGAGAWEAVLLGLGFKVECSGTRFGGLLLDLQSVDTVQYERLIQICIHIKRMVVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38420 Pentatricopeptide repeat (PPR)... Lus10019697 0 1
AT1G22540 Major facilitator superfamily ... Lus10001287 4.7 0.8152
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Lus10033866 9.3 0.8054
AT5G01110 Tetratricopeptide repeat (TPR)... Lus10028942 14.8 0.7970
AT5G19440 NAD(P)-binding Rossmann-fold s... Lus10008669 17.9 0.8133
AT1G22620 ATSAC1 suppressor of actin 1, Phospho... Lus10016941 18.4 0.8012
Lus10011631 25.9 0.7657
AT5G65550 UDP-Glycosyltransferase superf... Lus10028863 26.0 0.7924
AT5G14930 GENE101, SAG101 senescence-associated gene 101... Lus10004841 32.1 0.7826
AT5G10530 Concanavalin A-like lectin pro... Lus10020447 34.9 0.7758
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10009833 35.7 0.7912

Lus10019697 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.