Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	No hit found
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019698 pacid=23139250 polypeptide=Lus10019698 locus=Lus10019698.g ID=Lus10019698.BGIv1.0 annot-version=v1.0 ATGGCATCATTCAACGCCTCTTTCCTCGCCCTCTTCGCCGTCGTCGCGATCTTCGCGGCCGCCGTCTCAGCTCAGGAGATGGCTCCGGCGCCGGCCCCAG GCATGGACGCAGGAGCTGGATCTCTCTCAGCTGGAGTCTCCGGAGCTGTGATCTGCTCTTCCCTGGTGTTGTCTGCTCTCGCTCTCTTGAGGAACTAG
AA sequence Show only first row Show all	>Lus10019698 pacid=23139250 polypeptide=Lus10019698 locus=Lus10019698.g ID=Lus10019698.BGIv1.0 annot-version=v1.0 MASFNASFLALFAVVAIFAAAVSAQEMAPAPAPGMDAGAGSLSAGVSGAVICSSLVLSALALLRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019698 [exp]	0	1
AT3G06150			unknown protein		Lus10004424 [exp]	1.4	0.9182
AT4G29800		PLP8, PLAIVD ,P...	PATATIN-like protein 8 (.1.2)		Lus10036213 [exp]	1.7	0.9056
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10020416 [exp]	2.8	0.9102
					Lus10016421 [exp]	4.2	0.8772
AT1G64700			unknown protein		Lus10017341 [exp]	4.5	0.8939
AT5G08060			unknown protein		Lus10040513 [exp]	8.8	0.8827
AT3G25780		AOC3, AOC2	allene oxide cyclase 3 (.1)		Lus10017571 [exp]	10.2	0.8811
AT1G66080			unknown protein		Lus10010967 [exp]	12.4	0.8933
AT3G61770			Acid phosphatase/vanadium-depe...		Lus10030253 [exp]	15.2	0.8774
AT3G21890	CO		B-box type zinc finger family ...		Lus10031583 [exp]	15.8	0.8732

Compare expression of checked genes

Lus10019698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.