Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016420 [exp] 85 / 9e-24 ND / Lus10019700 [exp] 56 / 3e-12 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G062700 [exp] 46 / 2e-08 ND / Potri.001G268400 [exp] 39 / 8e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019699 pacid=23139307 polypeptide=Lus10019699 locus=Lus10019699.g ID=Lus10019699.BGIv1.0 annot-version=v1.0 ATGGCAGCCGTGCAAGTTAGCAGGTTCAGCGCCTTGGCCGTTCTAGTGATGGTCGCCGCTTACTTCACCGCCGTCTCAGCTCAGGCACCGGCGCCGTCGC CGGACCAGGGTGCTGCGTACACCATGGGTGCCTCTGGTGCCATGATTTGTAGCTCTCTGTTGCTTTCCCTGGCTGCTCTTTTGAGGAATTAA
AA sequence Show only first row Show all	>Lus10019699 pacid=23139307 polypeptide=Lus10019699 locus=Lus10019699.g ID=Lus10019699.BGIv1.0 annot-version=v1.0 MAAVQVSRFSALAVLVMVAAYFTAVSAQAPAPSPDQGAAYTMGASGAMICSSLLLSLAALLRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019699 [exp]	0	1
AT3G03341			unknown protein		Lus10009121 [exp]	5.8	0.6640
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10021719 [exp]	6.0	0.7662
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10021718 [exp]	7.7	0.7266
					Lus10016420 [exp]	11.0	0.7625
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10000502 [exp]	14.8	0.7429
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000072 [exp]	15.9	0.7243
AT3G54880			unknown protein		Lus10013824 [exp]	16.7	0.6762
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10013822 [exp]	17.2	0.7246
					Lus10037463 [exp]	17.3	0.7192
AT2G44810		DAD1	DEFECTIVE ANTHER DEHISCENCE 1,...		Lus10028210 [exp]	18.4	0.7156

Compare expression of checked genes

Lus10019699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.