Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019699 [exp] 48 / 4e-09 ND 33 / 0.009 Lus10016420 [exp] 40 / 5e-06 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G268500 [exp] 35 / 0.0005 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019700 pacid=23139241 polypeptide=Lus10019700 locus=Lus10019700.g ID=Lus10019700.BGIv1.0 annot-version=v1.0 ATGGCAGCAGTGCAGGTTACCAAGATGAATGCCTTGGCCGTGCTCTTGATGGTCGCCTTCTACTTCACCGCCGCCGTTTCTGCTCAGGCCCCGGCCCCGG CGCCGGGTCCCGACAAGGGTGCAGGATTCACCATGGGAGCTTCTGGTGCTGTGATTTGCAGCTCTCTGTTGCTTTCCCTGGTTGCTATGTTGAGGAATTG A
AA sequence Show only first row Show all	>Lus10019700 pacid=23139241 polypeptide=Lus10019700 locus=Lus10019700.g ID=Lus10019700.BGIv1.0 annot-version=v1.0 MAAVQVTKMNALAVLLMVAFYFTAAVSAQAPAPAPGPDKGAGFTMGASGAVICSSLLLSLVAMLRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10019700 [exp]	0	1
AT5G48560	bHLH	bHLH078	basic helix-loop-helix (bHLH) ...		Lus10002337 [exp]	2.8	0.8664
AT5G26667		PYR6	P-loop containing nucleoside t...		Lus10019509 [exp]	3.3	0.8687
AT1G18210			Calcium-binding EF-hand family...		Lus10042008 [exp]	4.4	0.8022
AT1G59900		AT-E1 ALPHA, AT...	pyruvate dehydrogenase complex...		Lus10030819 [exp]	9.8	0.8535
AT1G08750			Peptidase C13 family (.1.2.3)		Lus10006571 [exp]	11.7	0.8269
AT2G28250		NCRK	Protein kinase superfamily pro...		Lus10016098 [exp]	12.1	0.7401
AT1G29970		RPL18AA	60S ribosomal protein L18A-1 (...		Lus10013704 [exp]	13.9	0.7267
AT1G16560			Per1-like family protein (.1.2...		Lus10027411 [exp]	16.8	0.7417
AT5G27490			Integral membrane Yip1 family ...		Lus10031511 [exp]	16.9	0.8116
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10033902 [exp]	19.1	0.7900

Compare expression of checked genes

Lus10019700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.