Lus10019730 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G57450 65 / 2e-15 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016391 127 / 4e-40 AT3G57450 66 / 1e-15 unknown protein
Lus10029496 81 / 5e-22 AT3G57450 64 / 6e-15 unknown protein
Lus10035455 62 / 2e-14 AT3G57450 69 / 3e-17 unknown protein
Lus10031071 62 / 3e-14 AT3G57450 69 / 5e-17 unknown protein
Lus10042063 58 / 1e-12 AT3G57450 67 / 1e-15 unknown protein
Lus10018070 57 / 4e-12 AT3G57450 66 / 1e-15 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G263404 63 / 7e-15 AT3G57450 64 / 3e-15 unknown protein
Potri.016G055901 60 / 1e-13 AT3G57450 70 / 2e-17 unknown protein
Potri.009G058500 54 / 2e-11 AT3G57450 47 / 1e-08 unknown protein
Potri.006G050800 51 / 4e-10 AT3G57450 59 / 4e-13 unknown protein
Potri.012G032500 51 / 4e-10 AT3G57450 66 / 2e-15 unknown protein
PFAM info
Representative CDS sequence
>Lus10019730 pacid=23139312 polypeptide=Lus10019730 locus=Lus10019730.g ID=Lus10019730.BGIv1.0 annot-version=v1.0
ATGGCGAAGTACATGGAGATCCTGGACGCGTTCAGGATTGTGGCGAGGTTCCACTCTCATTGCCCCCAGACCGCTAGAATGTACTACCACCCGCCGGCTG
ACAACCACCAGACCCAGAGTCAGAACCAGCAAGGTGCAACCGTGGGAGAAGCTGCCGTCGTGGAAGCCAAATCGGGTTCTTACGCGGCGTTTAAAGGTGT
GAATCAGTTCGGTGTTGACGTCAGAGAGCTCGTTTAA
AA sequence
>Lus10019730 pacid=23139312 polypeptide=Lus10019730 locus=Lus10019730.g ID=Lus10019730.BGIv1.0 annot-version=v1.0
MAKYMEILDAFRIVARFHSHCPQTARMYYHPPADNHQTQSQNQQGATVGEAAVVEAKSGSYAAFKGVNQFGVDVRELV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G57450 unknown protein Lus10019730 0 1
AT5G43260 chaperone protein dnaJ-related... Lus10015783 4.1 0.7644
AT1G61065 Protein of unknown function (D... Lus10018474 7.6 0.7558
AT4G20780 CML42 calmodulin like 42 (.1) Lus10021134 8.2 0.6953
AT5G66320 GATA GATA5 GATA transcription factor 5 (.... Lus10031096 9.4 0.7135
AT1G76570 Chlorophyll A-B binding family... Lus10005421 14.5 0.7305
AT4G00050 bHLH bHLH016, UNE10 unfertilized embryo sac 10, ba... Lus10042874 15.2 0.7312
AT5G03910 ABCB29, ATATH12 ARABIDOPSIS THALIANA ABC TRANS... Lus10021349 16.4 0.7456
AT3G10970 Haloacid dehalogenase-like hyd... Lus10029053 18.0 0.6851
AT5G01410 PDX1, ATPDX1.3,... REDUCED SUGAR RESPONSE 4, ARAB... Lus10002486 20.5 0.7190
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Lus10014128 27.9 0.6974

Lus10019730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.