Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35580 52 / 2e-09 Serine protease inhibitor (SERPIN) family protein (.1) AT1G64030 49 / 4e-08 ATSRP3 serpin 3 (.1) AT3G45220 45 / 7e-07 Serine protease inhibitor (SERPIN) family protein (.1) AT1G47710 43 / 5e-06 Serine protease inhibitor (SERPIN) family protein (.1) AT2G25240 40 / 3e-05 Serine protease inhibitor (SERPIN) family protein (.1) AT1G64010 40 / 3e-05 Serine protease inhibitor (SERPIN) family protein (.1) AT1G62160 40 / 4e-05 Serine protease inhibitor (SERPIN) family protein (.1) AT2G26390 39 / 0.0001 Serine protease inhibitor (SERPIN) family protein (.1) AT1G62170 37 / 0.0005 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2) AT2G14540 37 / 0.0007 ATSRP2 serpin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019009 [exp] 70 / 1e-15 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1) Lus10040926 [exp] 67 / 8e-15 AT1G47710 115 / 2e-30 Serine protease inhibitor (SERPIN) family protein (.1) Lus10039336 [exp] 62 / 6e-13 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1) Lus10009905 [exp] 60 / 7e-13 AT2G14540 72 / 1e-15 serpin 2 (.1) Lus10032754 [exp] 48 / 1e-07 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1) Lus10002792 [exp] 45 / 1e-06 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1) Lus10032600 [exp] 41 / 3e-05 AT1G47710 99 / 6e-24 Serine protease inhibitor (SERPIN) family protein (.1) Lus10034362 [exp] 39 / 9e-05 AT1G47710 274 / 1e-89 Serine protease inhibitor (SERPIN) family protein (.1) Lus10034364 [exp] 39 / 0.0001 AT1G47710 296 / 4e-97 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G100900 [exp] 47 / 1e-07 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1) Potri.014G036000 [exp] 45 / 7e-07 AT1G47710 476 / 1e-168 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00079 [flax] [poplar] Serpin Serpin (serine protease inhibitor)
Representative CDS sequence Show only first row Show all	>Lus10019736 pacid=23139202 polypeptide=Lus10019736 locus=Lus10019736.g ID=Lus10019736.BGIv1.0 annot-version=v1.0 ATGTACAAAGGCACGCAACGATTTCGCTACGCAAGGTTCGAGGAATTCAAGGTGCTCGAGCTCCCTTACCAGACTGGAAGACCATGCGATGAAAGAGAGG AAGGCCCGTGTTTCTCAATGTACTTTTTCCTGCCGCACGAGGTAGACGGATTGCCAGCGATGCTTAGAAAATTCGGTGGGTCGTTTGAGGAATTATCACA AACACTTGGTGGGCTTGAGGATGTGCTGATGAAAAGGATCAAAATCCCCAAGTGGAAATCCTCCTAA
AA sequence Show only first row Show all	>Lus10019736 pacid=23139202 polypeptide=Lus10019736 locus=Lus10019736.g ID=Lus10019736.BGIv1.0 annot-version=v1.0 MYKGTQRFRYARFEEFKVLELPYQTGRPCDEREEGPCFSMYFFLPHEVDGLPAMLRKFGGSFEELSQTLGGLEDVLMKRIKIPKWKSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64030		ATSRP3	serpin 3 (.1)		Lus10019736 [exp]	0	1
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10031282 [exp]	4.9	0.6853
AT3G07820			Pectin lyase-like superfamily ...		Lus10002931 [exp]	5.7	0.6816
AT5G45310			unknown protein		Lus10022973 [exp]	9.9	0.6837
AT1G23540		IGI1, AtPERK12	proline-rich extensin-like rec...		Lus10013014 [exp]	25.5	0.6720
AT4G18425			Protein of unknown function (D...		Lus10015395 [exp]	58.2	0.6347
AT3G45770			Polyketide synthase, enoylredu...		Lus10020161 [exp]	58.8	0.6844
AT5G45820		PKS18, CIPK20, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10007283 [exp]	75.5	0.6634
AT3G07870			F-box and associated interacti...		Lus10012356 [exp]	96.9	0.6014
AT5G18910			Protein kinase superfamily pro...		Lus10012776 [exp]	98.2	0.6097
AT3G25810			Terpenoid cyclases/Protein pre...		Lus10038179 [exp]	98.7	0.6417

Compare expression of checked genes

Lus10019736 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.