Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29850 167 / 2e-55 Eukaryotic protein of unknown function (DUF872) (.1) AT2G19350 160 / 6e-53 Eukaryotic protein of unknown function (DUF872) (.1) AT3G29170 61 / 3e-13 Eukaryotic protein of unknown function (DUF872) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016385 [exp] 209 / 1e-70 AT4G29850 171 / 2e-55 Eukaryotic protein of unknown function (DUF872) (.1) Lus10039596 [exp] 176 / 4e-59 AT4G29850 169 / 3e-56 Eukaryotic protein of unknown function (DUF872) (.1) Lus10007465 [exp] 72 / 2e-17 AT3G29170 125 / 2e-38 Eukaryotic protein of unknown function (DUF872) (.1) Lus10028939 [exp] 42 / 2e-05 AT3G29170 80 / 3e-18 Eukaryotic protein of unknown function (DUF872) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G133500 [exp] 166 / 5e-55 AT4G29850 154 / 3e-50 Eukaryotic protein of unknown function (DUF872) (.1) Potri.006G072000 [exp] 163 / 8e-54 AT4G29850 176 / 6e-59 Eukaryotic protein of unknown function (DUF872) (.1) Potri.006G053300 [exp] 76 / 4e-19 AT3G29170 132 / 3e-41 Eukaryotic protein of unknown function (DUF872) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05915 [flax] [poplar] DUF872 Eukaryotic protein of unknown function (DUF872)
Representative CDS sequence Show only first row Show all	>Lus10019737 pacid=23139235 polypeptide=Lus10019737 locus=Lus10019737.g ID=Lus10019737.BGIv1.0 annot-version=v1.0 ATGGCGTATGTTGATCACGCTTTCTCCATCACAGACGACGACGATTTGATGTTGGACGGACCTTACAGCACCAGTAACCGTGCTCCGATCAAGGAGATCG CCCTTGCCGTCTCGCTACTCGTCTTCGGCGTCGTCGGCATCCTCGCCGGCTTTTTCATGGTCACCAACCGAGTCGGCGGCGACCGAGCCCACGGGATGTT CTTCGTGATATTGGGGGTGATTCTCTTCATACCGGGGTTCTATTACACCAGGATTGCTTACTACGCTTACAAAGGATACAAAGGCTTCTCCTTTTCCAAC ATTCCACCTGTATGA
AA sequence Show only first row Show all	>Lus10019737 pacid=23139235 polypeptide=Lus10019737 locus=Lus10019737.g ID=Lus10019737.BGIv1.0 annot-version=v1.0 MAYVDHAFSITDDDDLMLDGPYSTSNRAPIKEIALAVSLLVFGVVGILAGFFMVTNRVGGDRAHGMFFVILGVILFIPGFYYTRIAYYAYKGYKGFSFSN IPPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29850			Eukaryotic protein of unknown ...		Lus10019737 [exp]	0	1
AT1G08315			ARM repeat superfamily protein...		Lus10024145 [exp]	1.0	0.8874
AT4G29850			Eukaryotic protein of unknown ...		Lus10016385 [exp]	2.0	0.8552
AT4G29910		EMB2798, ORC5, ...	EMBRYO DEFECTIVE 2798, origin ...		Lus10036368 [exp]	2.8	0.8492
AT5G14280	GeBP		DNA-binding storekeeper protei...		Lus10036981 [exp]	7.1	0.8454
AT4G25000		AMY1, AMY3, ATA...	alpha-amylase-like (.1)		Lus10042655 [exp]	8.8	0.8056
AT3G17000		UBC32	ubiquitin-conjugating enzyme 3...		Lus10016898 [exp]	9.9	0.8498
AT3G06240			F-box family protein (.1)		Lus10037892 [exp]	10.6	0.8271
AT5G10530			Concanavalin A-like lectin pro...		Lus10029553 [exp]	13.4	0.8244
AT2G01150		RHA2B	RING-H2 finger protein 2B (.1)		Lus10013475 [exp]	13.4	0.8404
AT1G11050			Protein kinase superfamily pro...		Lus10001295 [exp]	15.5	0.8423

Compare expression of checked genes

Lus10019737 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.