Plant FIBer expression Database

Lus10019745 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13780 110 / 2e-32 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT1G03150 39 / 7e-05 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016378
[exp]
117 / 8e-35 AT5G13780 292 / 5e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10042595
[exp]
38 / 0.0002 AT1G03150 348 / 6e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G056600
[exp]
113 / 2e-33 AT5G13780 307 / 5e-108 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.001G261800
[exp]
112 / 6e-33 AT5G13780 301 / 8e-106 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.005G210400
[exp]
39 / 0.0001 AT1G03150 350 / 2e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence
>Lus10019745 pacid=23139233 polypeptide=Lus10019745 locus=Lus10019745.g ID=Lus10019745.BGIv1.0 annot-version=v1.0
ATGGAGGAGGAGTCGAACGAGTGCCACGGTCACATCACTTCTCTCGCCGTTCTCCGCACTCATCGCAAGTTGGGACTCGCCACTAAGCTCATGACCGCCG
CCCAGAGCGCCATGGAACAGGTATTTGGGGCAGAGTATGTGTCCCTGCACGTGAGGAAGAGTAACCGGGCGTCCCCCCCACCATCACCATCATCATGGCG
GTGGTTGTTGTGCGCCTCAGCCCAAACCAATTGA
AA sequence
>Lus10019745 pacid=23139233 polypeptide=Lus10019745 locus=Lus10019745.g ID=Lus10019745.BGIv1.0 annot-version=v1.0
MEEESNECHGHITSLAVLRTHRKLGLATKLMTAAQSAMEQVFGAEYVSLHVRKSNRASPPPSPSSWRWLLCASAQTN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13780 Acyl-CoA N-acyltransferases (N... Lus10019745
[exp]
0 1
Lus10006608
[exp]
2.4 0.8132
AT2G37230 Tetratricopeptide repeat (TPR)... Lus10021645
[exp]
5.3 0.8468
AT4G36130 Ribosomal protein L2 family (.... Lus10028468
[exp]
6.7 0.8754
AT4G38150 Pentatricopeptide repeat (PPR)... Lus10026570
[exp]
9.7 0.7867
AT3G51010 unknown protein Lus10026320
[exp]
15.3 0.7959
AT4G36130 Ribosomal protein L2 family (.... Lus10025966
[exp]
15.8 0.8141
AT3G57490 Ribosomal protein S5 family pr... Lus10014909
[exp]
16.2 0.8423
AT3G16080 Zinc-binding ribosomal protein... Lus10035878
[exp]
17.0 0.8180
AT1G61870 PPR336 pentatricopeptide repeat 336 (... Lus10006769
[exp]
21.5 0.7794
AT2G03820 nonsense-mediated mRNA decay N... Lus10023975
[exp]
24.7 0.7310

Lus10019745 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.