Lus10019746 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033089 61 / 5e-11 ND /
Lus10006097 56 / 1e-09 AT4G29090 43 / 8e-05 Ribonuclease H-like superfamily protein (.1)
Lus10017075 54 / 2e-09 ND /
Lus10033071 53 / 2e-08 ND 39 / 0.005
Lus10042896 42 / 9e-05 AT3G60380 91 / 1e-18 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10019746 pacid=23139272 polypeptide=Lus10019746 locus=Lus10019746.g ID=Lus10019746.BGIv1.0 annot-version=v1.0
ATGCACACCATCGCTGCCGCCGGTGTTCGATTGATGATCGGATTTCCGCCAAGCTGGCTAGGGTTTTCGGAGTCCGGAACTCGGGCTTTCCCTCGGTGGC
GGCTTATGAAGCAGTGGCGGAGAGATTTGACTATGTATAAACGTGGCTCTATTTTCCTTCGGCAGGTTTCCGGTCACACAACCAGTAAACTGCCCACATG
GACCGCCACCTTCAACTCCTCTACTGGTTTCGACTCCATTGGCGTGATTCGGCCAGACAGGTGCGGCACATTGGCTACATCAATAGGTCAGGTCCACTGC
TACCTCACGAATCCATTGGTGTTGGAGCTACTGGCAACCAGATGGGCGATCTCTTTGGCTTCCTCACATCCCGTGGTGTCTACCATTATCCATACCGATT
TAGTTGAGACTGTTCGGTTGCTGAACTCCACGGCTCCAGACATCAGATTCGGGCTCATACAAAATGAAACCCGACAACTGCTTCAGTCAGTTTCGCATAT
CTACATCAAATCGGTCCCTCGTCACGGATAA
AA sequence
>Lus10019746 pacid=23139272 polypeptide=Lus10019746 locus=Lus10019746.g ID=Lus10019746.BGIv1.0 annot-version=v1.0
MHTIAAAGVRLMIGFPPSWLGFSESGTRAFPRWRLMKQWRRDLTMYKRGSIFLRQVSGHTTSKLPTWTATFNSSTGFDSIGVIRPDRCGTLATSIGQVHC
YLTNPLVLELLATRWAISLASSHPVVSTIIHTDLVETVRLLNSTAPDIRFGLIQNETRQLLQSVSHIYIKSVPRHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019746 0 1
AT1G13340 Regulator of Vps4 activity in ... Lus10017592 3.9 0.6532
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10027430 4.1 0.7597
Lus10039750 5.8 0.7500
Lus10005187 7.3 0.7418
Lus10010117 8.5 0.7418
Lus10002152 9.5 0.7418
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025408 10.4 0.7418
AT2G25010 Aminotransferase-like, plant m... Lus10008761 11.2 0.7418
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10040338 12.0 0.7418
Lus10012774 13.4 0.7153

Lus10019746 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.