Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63460 179 / 8e-54 EMB2221 transducin family protein / WD-40 repeat family protein (.1.2.3) AT1G18830 151 / 8e-44 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016374 [exp] 213 / 3e-73 AT3G63460 181 / 4e-54 transducin family protein / WD-40 repeat family protein (.1.2.3) Lus10016373 [exp] 213 / 2e-65 AT3G63460 1299 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3) Lus10005323 [exp] 197 / 2e-61 AT3G63460 885 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3) Lus10039578 [exp] 200 / 8e-61 AT3G63460 1380 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G055400 [exp] 179 / 1e-53 AT3G63460 1351 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3) Potri.001G260900 [exp] 177 / 9e-53 AT3G63460 1347 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019751 pacid=23139191 polypeptide=Lus10019751 locus=Lus10019751.g ID=Lus10019751.BGIv1.0 annot-version=v1.0 ATGGCGTGTATCAAGTCCGTGAACAGATCGGCGTCGGTCGCTCTGGCGCCGGACGCTCCTTATTTGGCCGCCGGGACGATGGCCGGCGCGGTGGATCTGT CGTTCAGCTCCTCGGCCAACATCGAGATTTTCAAGCTCGATTTCCAGTCGGACGATCCTGATCTCCCGTTGGTTGGGGAGTCGCAGAGTACCGAGAGATT TAACCGTCTCGCTTGGGGGAAAAACGGATCCGGGTCCGAGCAGTATAGTATGGGACTCATTGCTGGTGGCCTCGTGGATGGGACTATTGGTATCTGGAAT CCATCAGCGTTGATCCGGTAA
AA sequence Show only first row Show all	>Lus10019751 pacid=23139191 polypeptide=Lus10019751 locus=Lus10019751.g ID=Lus10019751.BGIv1.0 annot-version=v1.0 MACIKSVNRSASVALAPDAPYLAAGTMAGAVDLSFSSSANIEIFKLDFQSDDPDLPLVGESQSTERFNRLAWGKNGSGSEQYSMGLIAGGLVDGTIGIWN PSALIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G63460		EMB2221	transducin family protein / WD...		Lus10019751 [exp]	0	1
AT5G24710			Transducin/WD40 repeat-like su...		Lus10028092 [exp]	1.4	0.9750
AT2G07360			SH3 domain-containing protein ...		Lus10027587 [exp]	1.4	0.9700
AT1G31730			Adaptin family protein (.1)		Lus10035684 [exp]	3.0	0.9629
AT4G19490		ATVPS54	ARABIDOPSIS THALIANA VPS54 HOM...		Lus10023393 [exp]	5.5	0.9583
AT2G44900		ARABIDILLO-1, A...	F-box Armadillo protein 1, ARA...		Lus10028197 [exp]	5.7	0.9182
AT2G45540			WD-40 repeat family protein / ...		Lus10015857 [exp]	7.2	0.9590
AT3G43300		BEN1, ATMIN7	BFA-VISUALIZED ENDOCYTIC TRAFF...		Lus10009803 [exp]	7.3	0.9574
AT5G06120			ARM repeat superfamily protein...		Lus10024115 [exp]	7.3	0.9307
AT1G49340		ATPI4K ALPHA, A...	Phosphatidylinositol 3- and 4-...		Lus10040481 [exp]	7.9	0.9495
AT1G31730			Adaptin family protein (.1)		Lus10037271 [exp]	8.6	0.9147

Compare expression of checked genes

Lus10019751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.