Lus10019753 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51990 174 / 2e-52 Protein kinase superfamily protein (.1)
AT1G28390 128 / 4e-34 Protein kinase superfamily protein (.1.2)
AT3G59420 100 / 9e-24 ACR4 crinkly4 (.1)
AT5G23170 96 / 9e-23 Protein kinase superfamily protein (.1)
AT3G09780 81 / 3e-17 CCR1, ATCRR1 CRINKLY4 related 1 (.1)
AT5G47850 78 / 3e-16 CCR4 CRINKLY4 related 4 (.1)
AT1G07550 78 / 3e-16 Leucine-rich repeat protein kinase family protein (.1)
AT1G21245 74 / 3e-16 Protein kinase superfamily protein (.1)
AT5G65530 77 / 5e-16 Protein kinase superfamily protein (.1)
AT5G18910 77 / 8e-16 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016371 437 / 1e-153 AT3G51990 402 / 3e-138 Protein kinase superfamily protein (.1)
Lus10039770 124 / 2e-32 AT1G28390 379 / 2e-127 Protein kinase superfamily protein (.1.2)
Lus10019948 96 / 1e-23 AT3G51990 174 / 3e-52 Protein kinase superfamily protein (.1)
Lus10000764 98 / 5e-23 AT3G59420 1255 / 0.0 crinkly4 (.1)
Lus10015478 93 / 6e-22 AT3G51990 169 / 2e-49 Protein kinase superfamily protein (.1)
Lus10015956 93 / 3e-21 AT3G59420 1258 / 0.0 crinkly4 (.1)
Lus10011098 86 / 1e-18 AT3G24550 700 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1)
Lus10043219 84 / 3e-18 AT3G24550 688 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1)
Lus10023645 83 / 8e-18 AT3G24550 691 / 0.0 proline-rich extensin-like receptor kinase 1, proline extensin-like receptor kinase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G055200 278 / 1e-91 AT3G51990 409 / 7e-141 Protein kinase superfamily protein (.1)
Potri.001G260800 274 / 7e-91 AT3G51990 419 / 5e-146 Protein kinase superfamily protein (.1)
Potri.005G158600 139 / 3e-38 AT1G28390 397 / 3e-134 Protein kinase superfamily protein (.1.2)
Potri.004G221800 114 / 8e-30 AT5G23170 273 / 1e-89 Protein kinase superfamily protein (.1)
Potri.003G010300 110 / 3e-28 AT5G23170 270 / 3e-88 Protein kinase superfamily protein (.1)
Potri.017G029900 102 / 2e-24 AT3G59420 1264 / 0.0 crinkly4 (.1)
Potri.007G128400 99 / 2e-23 AT3G59420 1264 / 0.0 crinkly4 (.1)
Potri.014G136300 85 / 1e-18 AT5G35960 556 / 0.0 Protein kinase family protein (.1)
Potri.006G166600 82 / 1e-17 AT2G18890 463 / 3e-163 Protein kinase superfamily protein (.1.2)
Potri.010G213200 81 / 5e-17 AT3G46290 808 / 0.0 hercules receptor kinase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence
>Lus10019753 pacid=23139299 polypeptide=Lus10019753 locus=Lus10019753.g ID=Lus10019753.BGIv1.0 annot-version=v1.0
ATGGGGTATCTCGATCCTTGCTACGTCACGCCCGATAACTTGAGCACCAAAACTGATGTTTTCAGCTTTGGGATTCTGTTGCTGGAGATTATCAGTGGGA
GGAAAGCCATTGATGTGGATCATTCCCCTGCTTCCATTGTCGATTGGGCGATCCCTCTGTTGAAAAGAGGGAAGCTTGGTCTTATCTACGATCTGAGGAT
TCCGTTACTCAAGGATCCATTGATCAAGAGGCAGCTTGTTCTGATTGCTTCCAAATGTGTTAGGTCTTGCAGGGAGAGGAGGCCGTCTATGAAGGAAGTT
GTTGATTGGTTGAACGCATTGAGCAAGCTGGTTCCTCTCCATTCGTGGAACGGGTTCAACAATCCCTGTATGATGGTCGAGACCATGGAGCGTCCTGCTG
AATTGAGGAACTGCGAATTTGAATTGAGAACGGCGAAGGATTCAAGAAGGGTGTTCTCGGACTTGGGGTCGAGAAGCAGTTTGATCGACCTCATGGCTGG
TGGTGAGTCTGATTCGATGAGACAGCCCTCGAGTCGGTTTTCGCGTTCCATATTCGGTAGTGCGAGGTATGTTGCAGGAGGAGGAAGAAGAACTACACAG
TCCAAGACTGTGAGTAGTAGTAATAGTAGTGATAACAAAGTTGTTTCTTGTATGCGGAGAAACAAATCAGTCGGGGATGGTTCGAAGTTCGTCTCTGAAA
CAAAAGAGAAAGCTCCTCCTGCTCATTCGAGACTTAGGGGTGAAAGGTTGGTAAGCTCTTCCTGA
AA sequence
>Lus10019753 pacid=23139299 polypeptide=Lus10019753 locus=Lus10019753.g ID=Lus10019753.BGIv1.0 annot-version=v1.0
MGYLDPCYVTPDNLSTKTDVFSFGILLLEIISGRKAIDVDHSPASIVDWAIPLLKRGKLGLIYDLRIPLLKDPLIKRQLVLIASKCVRSCRERRPSMKEV
VDWLNALSKLVPLHSWNGFNNPCMMVETMERPAELRNCEFELRTAKDSRRVFSDLGSRSSLIDLMAGGESDSMRQPSSRFSRSIFGSARYVAGGGRRTTQ
SKTVSSSNSSDNKVVSCMRRNKSVGDGSKFVSETKEKAPPAHSRLRGERLVSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51990 Protein kinase superfamily pro... Lus10019753 0 1
AT3G51990 Protein kinase superfamily pro... Lus10016371 2.2 0.8869
AT1G22610 C2 calcium/lipid-binding plant... Lus10009459 5.7 0.9012
AT4G10840 Tetratricopeptide repeat (TPR)... Lus10017304 6.9 0.8968
AT3G03210 unknown protein Lus10031359 10.5 0.8937
AT3G03450 GRAS RGL2 RGA-like 2 (.1) Lus10016897 11.0 0.8936
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10034651 14.4 0.8797
AT1G60190 AtPUB19 plant U-box 19, ARM repeat sup... Lus10029163 16.4 0.8075
AT1G65730 YSL7 YELLOW STRIPE like 7 (.1) Lus10043408 16.9 0.8682
AT2G17800 ARAC1, ATGP2, A... RHO-RELATED GTPASES FROM PLANT... Lus10041881 16.9 0.8633
AT2G37090 IRX9 IRREGULAR XYLEM 9, Nucleotide-... Lus10015069 20.3 0.8777

Lus10019753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.