Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35040 79 / 6e-19 bZIP bZIP19 Basic-leucine zipper (bZIP) transcription factor family protein (.1) AT2G16770 69 / 3e-15 bZIP bZIP23 Basic-leucine zipper (bZIP) transcription factor family protein (.1) AT3G51960 61 / 2e-12 bZIP ATBZIP24 basic leucine zipper 24 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016368 [exp] 135 / 2e-42 AT4G35040 135 / 5e-40 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10005073 [exp] 73 / 1e-16 AT4G35040 294 / 2e-99 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10027847 [exp] 72 / 5e-16 AT2G16770 295 / 1e-100 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10014121 [exp] 62 / 6e-13 AT2G16770 265 / 8e-90 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G204400 [exp] 82 / 1e-20 AT2G16770 151 / 5e-45 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.001G020200 [exp] 76 / 4e-18 AT2G16770 120 / 9e-33 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.009G134900 [exp] 76 / 1e-17 AT4G35040 291 / 2e-99 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.004G175200 [exp] 71 / 4e-16 AT4G35040 267 / 6e-90 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0018 [flax] [poplar] bZIP PF07716 [flax] [poplar] bZIP_2 Basic region leucine zipper
Representative CDS sequence Show only first row Show all	>Lus10019756 pacid=23139262 polypeptide=Lus10019756 locus=Lus10019756.g ID=Lus10019756.BGIv1.0 annot-version=v1.0 ATGATTCCACCTGAAACGTCATTAGAGGACAGTACTGCTTACAACTGCAATTTGAAGGAGACGGCGAAGAGGCCATTGGGAAACAGGGCGGCAGTGACGA AATACCGCGAGAAGAATGCAGACGTAGCGTACTTGGAGGAACAAGTGAAGAAGCTTCGCGTGTTGAACCAGCGGCTGGTGATGAAGCTGCAAAGACAGGC CATGTTGGAGTACGAGGTTGTGAGGCTCAGAGGGTTGTTTGATTTCAGAGTAAAGATTGATCATCTTGAGTTAGAAAGCTGTCCTTATGGAAAAGCGAAG TGA
AA sequence Show only first row Show all	>Lus10019756 pacid=23139262 polypeptide=Lus10019756 locus=Lus10019756.g ID=Lus10019756.BGIv1.0 annot-version=v1.0 MIPPETSLEDSTAYNCNLKETAKRPLGNRAAVTKYREKNADVAYLEEQVKKLRVLNQRLVMKLQRQAMLEYEVVRLRGLFDFRVKIDHLELESCPYGKAK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35040	bZIP	bZIP19	Basic-leucine zipper (bZIP) tr...		Lus10019756 [exp]	0	1
					Lus10001533 [exp]	7.8	0.8472
AT5G54390		ATAHL, AHL	HAL2-like (.1)		Lus10011231 [exp]	9.5	0.8262
AT5G01930		MAN6, AtMAN6	endo-beta-mannase 6, Glycosyl ...		Lus10022729 [exp]	12.8	0.8439
AT2G27310			F-box family protein (.1)		Lus10013309 [exp]	13.7	0.8384
AT3G49210			O-acyltransferase (WSD1-like) ...		Lus10033680 [exp]	15.7	0.8392
AT3G07070			Protein kinase superfamily pro...		Lus10011866 [exp]	16.8	0.8336
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10031958 [exp]	17.6	0.8344
AT3G43860		ATGH9A4	glycosyl hydrolase 9A4 (.1)		Lus10009794 [exp]	25.0	0.8235
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	26.3	0.8130
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	27.1	0.8130

Compare expression of checked genes

Lus10019756 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.