Plant FIBer expression Database

Lus10019763 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G20740 104 / 3e-27 EMB3131 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016361
[exp]
179 / 5e-54 AT4G20740 914 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10019764
[exp]
164 / 6e-50 AT4G20740 590 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G203100
[exp]
116 / 2e-31 AT4G20740 964 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10019763 pacid=23139295 polypeptide=Lus10019763 locus=Lus10019763.g ID=Lus10019763.BGIv1.0 annot-version=v1.0
ATGCCACCCAACTCCCCGCCACCGTCCGCTTCACAGAAATTCTACTTCTTCTACGGCCACCGAAAACCCTCTCAGAACCGCCCCATAGTCCGCGGCGGCG
TATTCACAAACCGCAAACCTTCCAAACCTCCTCCCAACGAATCAATCTCCTCTCCGAACAAAAAAAACCCCTTTTCTCCATTCGACATCACAAAATGGGA
CCCACAACACCCATCACCGCCGCCGGCGAGTTCTCCTCCGCCGCGCTCTCTGGCCGTCTCCGAGCGCCTCTCCCCGATCGCCCGGTTCGTGGTCGACGCC
TTCCGTAAGAACGGAAACCACTGGGGCCCACCGGTGGTAGCCGAGCTCCGCTAG
AA sequence
>Lus10019763 pacid=23139295 polypeptide=Lus10019763 locus=Lus10019763.g ID=Lus10019763.BGIv1.0 annot-version=v1.0
MPPNSPPPSASQKFYFFYGHRKPSQNRPIVRGGVFTNRKPSKPPPNESISSPNKKNPFSPFDITKWDPQHPSPPPASSPPPRSLAVSERLSPIARFVVDA
FRKNGNHWGPPVVAELR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G20740 EMB3131 EMBRYO DEFECTIVE 3131, Pentatr... Lus10019763
[exp]
0 1
AT5G35753 Domain of unknown function (DU... Lus10012334
[exp]
4.2 0.8478
AT1G13190 RNA-binding (RRM/RBD/RNP motif... Lus10038759
[exp]
6.5 0.8080
AT4G35870 early-responsive to dehydratio... Lus10028409
[exp]
11.5 0.7902
AT5G47660 Trihelix Homeodomain-like superfamily p... Lus10038779
[exp]
23.0 0.7426
AT2G15820 OTP51 ORGANELLE TRANSCRIPT PROCESSIN... Lus10020996
[exp]
23.0 0.7875
AT4G38870 F-box and associated interacti... Lus10003705
[exp]
26.6 0.7893
AT1G43770 RING/FYVE/PHD zinc finger supe... Lus10028603
[exp]
34.6 0.7750
AT4G22720 Actin-like ATPase superfamily ... Lus10029108
[exp]
36.2 0.7283
AT5G51300 splicing factor-related (.1.2.... Lus10038932
[exp]
36.8 0.7804
AT5G44800 PKR1, CHR4, MI-... PICKLE RELATED 1, chromatin re... Lus10009558
[exp]
42.8 0.7295

Lus10019763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.