Lus10019765 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G20740 287 / 2e-92 EMB3131 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G62930 87 / 4e-19 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G20090 84 / 4e-18 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G64320 84 / 5e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62670 83 / 6e-18 RPF2 rna processing factor 2 (.1)
AT1G12620 82 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22470 82 / 1e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63400 81 / 3e-17 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G06710 79 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12775 79 / 2e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016361 453 / 8e-157 AT4G20740 914 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10013841 85 / 2e-18 AT5G65560 868 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10026558 85 / 3e-18 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10008593 82 / 2e-17 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10036020 82 / 2e-17 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042529 82 / 3e-17 AT5G65560 498 / 1e-160 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10037968 81 / 4e-17 AT5G55840 1131 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012139 81 / 5e-17 AT5G59900 987 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013283 81 / 5e-17 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G203100 362 / 4e-121 AT4G20740 964 / 0.0 EMBRYO DEFECTIVE 3131, Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.007G123600 87 / 3e-19 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G131400 85 / 2e-18 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G034300 84 / 3e-18 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G014500 84 / 4e-18 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G050240 84 / 5e-18 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.014G117600 82 / 1e-17 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G032600 81 / 3e-17 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050180 81 / 3e-17 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.015G105400 81 / 7e-17 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10019765 pacid=23139217 polypeptide=Lus10019765 locus=Lus10019765.g ID=Lus10019765.BGIv1.0 annot-version=v1.0
ATGGAGAGATTAGGGTTTGGAGTTCTTGACGATCTGTCGAAGTTCTTGTCCTGCATGGTTGAGAAGGGCGAGAGGACGATTTTGGCACTCGAAGTGTTTC
GGGATCTGAAAGCAAGAGGGTATAGCAGTGTTGAAATGTACAATGTACTTATGGAGGCACTCTTGAAGGATGGCGAGGTGAAAAAGGCATTATCTTTATT
CGACGAGATGAAAGATTCGAACTTTGAACCGAATTTGGATAGTTACAGCATTGTGGTTTCATGTTTTGTTGAAGACGGCAAGATCAAGGATGCTTGCCAT
TGTCATAATAAGATAATTGAGATGGCATGTGTTCCTTCTGTTGCTGCATATAGTTCTTTAGCTAAGGGGCTATGCAAACTCGGAGAGATCGATGCCGCTA
TGATGCTTGTTCGCGATTGTCTTGGCAATGTCGTTAGTGGACCGATGGACTTCAAGTACAGTCTCGCGATTATACACTCGTGTAAATCGGGCGGAGCGGA
CATGGTTATGGAAGTTGTTAATGAGATGATGAAGGAAGGTGTGCCTCCCAATGAAATCATATGCTCTGCCGTGATCTTTGGAATGTGCAAGCATGGAACT
TTGGAAGCGGCGAGGCAGGTTTTCGCCACTTTGAGGGAGCGCAGGATTCTAACGGAAGCCAAGACCATTGTCTATGACGAGATTTTGATCGATCACATGA
AGAGGAAGGCAGCTGACTTGGTGCTCTCGGGGTTGAAGTTTTTCGGGCTGGAGTCGAAACTAAAGGCCAAAGGGAGTACGCTTCTGTCAACTTGA
AA sequence
>Lus10019765 pacid=23139217 polypeptide=Lus10019765 locus=Lus10019765.g ID=Lus10019765.BGIv1.0 annot-version=v1.0
MERLGFGVLDDLSKFLSCMVEKGERTILALEVFRDLKARGYSSVEMYNVLMEALLKDGEVKKALSLFDEMKDSNFEPNLDSYSIVVSCFVEDGKIKDACH
CHNKIIEMACVPSVAAYSSLAKGLCKLGEIDAAMMLVRDCLGNVVSGPMDFKYSLAIIHSCKSGGADMVMEVVNEMMKEGVPPNEIICSAVIFGMCKHGT
LEAARQVFATLRERRILTEAKTIVYDEILIDHMKRKAADLVLSGLKFFGLESKLKAKGSTLLST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G20740 EMB3131 EMBRYO DEFECTIVE 3131, Pentatr... Lus10019765 0 1
AT4G19950 unknown protein Lus10018322 8.8 0.8101
AT1G30480 DRT111 DNA-DAMAGE-REPAIR/TOLERATION P... Lus10023355 10.2 0.8140
AT2G29900 PS2 Presenilin-2 (.1) Lus10035137 24.0 0.7814
AT5G10730 NAD(P)-binding Rossmann-fold s... Lus10020108 26.9 0.7847
AT4G34740 CIA1, ATASE2, A... CHLOROPLAST IMPORT APPARATUS 1... Lus10018062 27.5 0.7383
AT1G31830 Amino acid permease family pro... Lus10012153 31.1 0.7905
AT1G08700 PS1 Presenilin-1 (.1) Lus10020339 34.1 0.7792
AT5G36230 ARM repeat superfamily protein... Lus10029667 34.7 0.7242
Lus10007581 41.3 0.7715
AT1G15230 unknown protein Lus10025791 41.4 0.7289

Lus10019765 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.