Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17080 50 / 2e-08 Plant self-incompatibility protein S1 family (.1) AT4G16195 49 / 4e-08 Plant self-incompatibility protein S1 family (.1) AT4G29035 47 / 1e-07 Plant self-incompatibility protein S1 family (.1) AT3G26880 45 / 1e-06 Plant self-incompatibility protein S1 family (.1) AT4G16295 45 / 1e-06 SPH1 S-protein homologue 1 (.1) AT3G16970 45 / 2e-06 Plant self-incompatibility protein S1 family (.1) AT5G04347 42 / 1e-05 Plant self-incompatibility protein S1 family (.1) AT5G12060 41 / 3e-05 Plant self-incompatibility protein S1 family (.1) AT4G24973 40 / 8e-05 Plant self-incompatibility protein S1 family (.1) AT1G11765 39 / 0.0001 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019768 [exp] 123 / 3e-37 AT4G16195 50 / 2e-08 Plant self-incompatibility protein S1 family (.1) Lus10016360 [exp] 110 / 3e-29 AT4G30890 494 / 7e-170 ubiquitin-specific protease 24 (.1.2.3) Lus10002747 [exp] 82 / 3e-21 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10023085 [exp] 79 / 8e-20 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10016330 [exp] 72 / 5e-17 AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10018785 [exp] 70 / 4e-16 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1) Lus10032383 [exp] 69 / 6e-16 AT4G24975 40 / 5e-05 Plant self-incompatibility protein S1 family (.1) Lus10016329 [exp] 68 / 2e-15 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10023194 [exp] 62 / 2e-13 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G008300 [exp] 54 / 5e-10 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 49 / 3e-08 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.016G066900 [exp] 44 / 5e-06 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 40 / 6e-05 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10019767 pacid=23139316 polypeptide=Lus10019767 locus=Lus10019767.g ID=Lus10019767.BGIv1.0 annot-version=v1.0 ATGGCTAAACTAGTAGTATCATCAGTGTTCAAATTGGTGTGCGGGATGATGATGATAATGGCGTGTTCCTCCAACGAGGAACGGAGCACAATTCAACTTA CCAATGATCTAGGCGAGACGGTGACCGCTCACTGCCGATCGAAAGGTAGCAGAATTCGTGCCGATAAAATCGAACCCGGTTCTACATTGAGCTGGAGTTT CAACGACAATATCATTTGTTCTACTCTTTTCTGGTGCGACCTTTCCGTGGAAGACAAGCATCTTCATTTCGACATATACAAGTGCAACGCGGAGTCGGAG TACCCAACTCGCTGGTGGATCGACGATGAAGGGGTTTATTCGGTCGACTTTATAAGTTTCCGCTATAAGTGGGAACACTAA
AA sequence Show only first row Show all	>Lus10019767 pacid=23139316 polypeptide=Lus10019767 locus=Lus10019767.g ID=Lus10019767.BGIv1.0 annot-version=v1.0 MAKLVVSSVFKLVCGMMMIMACSSNEERSTIQLTNDLGETVTAHCRSKGSRIRADKIEPGSTLSWSFNDNIICSTLFWCDLSVEDKHLHFDIYKCNAESE YPTRWWIDDEGVYSVDFISFRYKWEH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29035			Plant self-incompatibility pro...		Lus10019767 [exp]	0	1
AT1G63060			unknown protein		Lus10001796 [exp]	2.2	0.8659
AT1G63060			unknown protein		Lus10002567 [exp]	3.2	0.8659
					Lus10041320 [exp]	5.5	0.8349
AT5G45840			Leucine-rich repeat protein ki...		Lus10007281 [exp]	5.7	0.8151
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Lus10006141 [exp]	6.7	0.8074
AT3G22060			Receptor-like protein kinase-r...		Lus10022286 [exp]	7.0	0.7802
					Lus10040835 [exp]	7.3	0.7995
AT2G20710			Tetratricopeptide repeat (TPR)...		Lus10029335 [exp]	7.4	0.7264
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10001886 [exp]	8.9	0.7735
					Lus10030519 [exp]	9.2	0.7254

Compare expression of checked genes

Lus10019767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.