Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16195 48 / 8e-08 Plant self-incompatibility protein S1 family (.1) AT4G16295 45 / 2e-06 SPH1 S-protein homologue 1 (.1) AT3G17080 43 / 5e-06 Plant self-incompatibility protein S1 family (.1) AT4G29035 42 / 2e-05 Plant self-incompatibility protein S1 family (.1) AT3G16970 40 / 6e-05 Plant self-incompatibility protein S1 family (.1) AT5G12060 39 / 0.0001 Plant self-incompatibility protein S1 family (.1) AT1G04645 37 / 0.0006 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019767 [exp] 123 / 2e-37 AT4G29035 50 / 1e-08 Plant self-incompatibility protein S1 family (.1) Lus10023085 [exp] 73 / 2e-17 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 63 / 6e-14 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10032383 [exp] 61 / 7e-13 AT4G24975 40 / 5e-05 Plant self-incompatibility protein S1 family (.1) Lus10016360 [exp] 64 / 1e-12 AT4G30890 494 / 7e-170 ubiquitin-specific protease 24 (.1.2.3) Lus10018785 [exp] 60 / 2e-12 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1) Lus10016329 [exp] 56 / 1e-10 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10038163 [exp] 53 / 1e-09 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1) Lus10023195 [exp] 52 / 3e-09 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G252500 [exp] 51 / 9e-09 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.010G008300 [exp] 47 / 1e-07 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 40 / 5e-05 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.016G066900 [exp] 39 / 0.0003 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 38 / 0.0005 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10019768 pacid=23139256 polypeptide=Lus10019768 locus=Lus10019768.g ID=Lus10019768.BGIv1.0 annot-version=v1.0 ATGGCTATGATAATCAAATTAGTCTGCGTAATGATGATGATGATGATGGCTTGTTCCTCCGCCAGCCAAGTGAAGACAGTGTCTCTGAACAACGATTATG GCCAGACAGTGAACGCCTACTGCCAATCAAAACACGACAAAATTCGCGGCAACACAATCGACCCTGGTTCTGCATTGAGTTGGAGTTTCAAGGAGAATCC CTTCAAATCTACGCTCTTCTGGTGCGACATTGATGTCGATGGCAAGCATCTTCATTTCGACATATACAAGTGCACGAATGGCATGTACCCAACTGAATGG CGGATCGACAATGACGGGGTTCATTCCACCACCGTTCCACGTCTCAGCTTTTCATGGAACCAGCTCTAG
AA sequence Show only first row Show all	>Lus10019768 pacid=23139256 polypeptide=Lus10019768 locus=Lus10019768.g ID=Lus10019768.BGIv1.0 annot-version=v1.0 MAMIIKLVCVMMMMMMACSSASQVKTVSLNNDYGQTVNAYCQSKHDKIRGNTIDPGSALSWSFKENPFKSTLFWCDIDVDGKHLHFDIYKCTNGMYPTEW RIDNDGVHSTTVPRLSFSWNQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16195			Plant self-incompatibility pro...		Lus10019768 [exp]	0	1
					Lus10014737 [exp]	1.7	1.0000
AT1G04520		PDLP2	plasmodesmata-located protein ...		Lus10028049 [exp]	2.4	1.0000
AT3G04060	NAC	ANAC046	NAC domain containing protein ...		Lus10033699 [exp]	3.0	1.0000
					Lus10021773 [exp]	4.0	1.0000
AT4G27170		SESA4, AT2S4	seed storage albumin 4 (.1)		Lus10040395 [exp]	4.5	1.0000
					Lus10039552 [exp]	4.9	1.0000
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10035900 [exp]	5.3	1.0000
					Lus10019558 [exp]	5.7	1.0000
AT5G51710		ATKEA5, KEA5	K+ efflux antiporter 5, ARABID...		Lus10008000 [exp]	6.0	0.9920
AT3G51560			Disease resistance protein (TI...		Lus10029858 [exp]	7.4	0.9780

Compare expression of checked genes

Lus10019768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.