Lus10019769 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41430 91 / 9e-24 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
AT4G14270 77 / 2e-18 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031029 94 / 2e-25 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10035419 93 / 7e-25 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10018018 90 / 2e-23 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10042014 89 / 6e-23 AT2G41430 99 / 1e-27 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10040964 68 / 7e-15 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10009847 59 / 1e-11 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10016358 0 / 1 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G023100 141 / 3e-43 AT4G14270 89 / 3e-23 unknown protein
Potri.003G202500 124 / 2e-36 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.016G041600 95 / 2e-25 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.006G044600 94 / 4e-25 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.008G074600 74 / 2e-17 AT4G14270 66 / 2e-14 unknown protein
Potri.010G182800 73 / 9e-17 AT4G14270 65 / 6e-14 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07145 PAM2 Ataxin-2 C-terminal region
Representative CDS sequence
>Lus10019769 pacid=23139302 polypeptide=Lus10019769 locus=Lus10019769.g ID=Lus10019769.BGIv1.0 annot-version=v1.0
ATGGCGATGGTGTCGGGGCAGAGGTCGGCGCTTAACCCCAACGCGCCGGCATTCGTGCCGGCTGTGTACCAGCGAGTGGAGGATTTCTCACCGGAGTGGT
GGGAGCTCGTGAAGAGCTCGACGTGGTTCCGCGATTACTGGCTAAGCGTGAATCCGGAGGGAAGCTTCGACGACGAAATAATCGAGGCTCTACTGCCGGA
AGAAATCGACCTGGCGGCGGATATGACGGACACAATAGCTGGAGATGTGAAAAAACCTAGTGTGGAATCCGAGAAATCCAACGCTCTGAACGGACTGATC
GTGGACGCAAAGGCGTTACTGAGAGATCTGAATCAGTCGCCGACAAGGTCACCGAAGGGGAAGAGTCCGAGATCGGGAGTGGAACCGGCGAAGTTCCAGA
TGAGGCCGGTGGGAACCCGTGTGGGAAGTCCCAGGTCCGGTGGACGCCGGATCCAGCAGCCTCGTTGA
AA sequence
>Lus10019769 pacid=23139302 polypeptide=Lus10019769 locus=Lus10019769.g ID=Lus10019769.BGIv1.0 annot-version=v1.0
MAMVSGQRSALNPNAPAFVPAVYQRVEDFSPEWWELVKSSTWFRDYWLSVNPEGSFDDEIIEALLPEEIDLAADMTDTIAGDVKKPSVESEKSNALNGLI
VDAKALLRDLNQSPTRSPKGKSPRSGVEPAKFQMRPVGTRVGSPRSGGRRIQQPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10019769 0 1
AT3G15040 Protein of unknown function, D... Lus10034190 2.8 0.8890
AT5G53120 SPMS, SPDS3, AT... spermidine synthase 3 (.1.2.3.... Lus10003398 5.3 0.8603
AT2G20780 AtPLT4 Major facilitator superfamily ... Lus10033702 7.1 0.8773
AT4G36750 Quinone reductase family prote... Lus10041718 8.2 0.8472
AT4G02340 alpha/beta-Hydrolases superfam... Lus10009859 8.4 0.8554
AT5G13810 Glutaredoxin family protein (.... Lus10039537 8.8 0.8649
AT1G54115 ATCCX4 cation calcium exchanger 4 (.1... Lus10015668 11.6 0.8496
AT1G55910 ZIP11 zinc transporter 11 precursor ... Lus10016609 13.8 0.8667
AT3G48560 TZP5, IMR1, ALS... TRIAZOLOPYRIMIDINE RESISTANT 5... Lus10035359 14.1 0.8549
AT5G58375 Methyltransferase-related prot... Lus10008585 14.9 0.8744

Lus10019769 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.