Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G33550 82 / 4e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G56480 53 / 5e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G32280 50 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016357 [exp] 207 / 9e-71 AT4G30880 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019029 [exp] 79 / 6e-20 AT4G33550 106 / 7e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005010 [exp] 73 / 5e-18 AT4G33550 89 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 57 / 2e-11 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019030 [exp] 54 / 2e-10 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 53 / 4e-10 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G023200 [exp] 110 / 2e-32 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023300 [exp] 106 / 7e-31 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049300 [exp] 73 / 9e-18 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G048900 [exp] 65 / 1e-14 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049000 [exp] 61 / 4e-13 AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048800 [exp] 58 / 7e-12 AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G084000 [exp] 54 / 3e-10 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10019770 pacid=23139199 polypeptide=Lus10019770 locus=Lus10019770.g ID=Lus10019770.BGIv1.0 annot-version=v1.0 ATGTCATCAGTCACCAAACTAGCTCTACTAGTCGTGACCATCACCGCTGCGGTGATGGTCGGTCACTCCGACGGGCAAGCAATCGGGTGTGCTGGCGACA TGCCAGGCTTGGTAATGCAGTGTGCTAGGTTCGTCCAAAAGATCGGCCCTGTCGCCGACCCTTCCCCTCCGTGTTGCACCGCCCTCAAGACGGCGGACAT CCCTTGCGTATGCGGTCGAATCCCCAACGAGGTCGCGGCCATGGTCGACATGAACAAGGTCGTCCATGTGGTCGACTTCTGCGGCGTCGTCCTCCCCCAT GGACTCAAATGTGGAGATTTTACAGTTCCTGGAGCAATGGAGAAGAAGCTGCATGCTTGA
AA sequence Show only first row Show all	>Lus10019770 pacid=23139199 polypeptide=Lus10019770 locus=Lus10019770.g ID=Lus10019770.BGIv1.0 annot-version=v1.0 MSSVTKLALLVVTITAAVMVGHSDGQAIGCAGDMPGLVMQCARFVQKIGPVADPSPPCCTALKTADIPCVCGRIPNEVAAMVDMNKVVHVVDFCGVVLPH GLKCGDFTVPGAMEKKLHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30880			Bifunctional inhibitor/lipid-t...		Lus10019770 [exp]	0	1
					Lus10000363 [exp]	4.1	1.0000
AT3G10340		PAL4	phenylalanine ammonia-lyase 4 ...		Lus10001405 [exp]	5.1	1.0000
					Lus10003285 [exp]	7.1	1.0000
AT3G27080		TOM20-3	translocase of outer membrane ...		Lus10041558 [exp]	7.5	1.0000
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10027745 [exp]	8.1	1.0000
					Lus10004996 [exp]	8.2	1.0000
AT1G61330			FBD, F-box and Leucine Rich Re...		Lus10006726 [exp]	8.8	1.0000
AT3G56970	bHLH	ORG2, bHLH038	OBP3-RESPONSIVE GENE 3, basic ...		Lus10010453 [exp]	10.7	0.9978
AT5G56610			Phosphotyrosine protein phosph...		Lus10034998 [exp]	11.0	0.9356
					Lus10025781 [exp]	11.2	1.0000

Compare expression of checked genes

Lus10019770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.