Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38580 254 / 3e-88 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G35060 216 / 3e-73 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 200 / 6e-67 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 160 / 3e-51 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 157 / 3e-50 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 140 / 2e-43 Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 139 / 1e-42 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 135 / 2e-41 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G06330 89 / 7e-23 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 81 / 2e-19 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014120 [exp] 313 / 1e-111 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10028426 [exp] 213 / 6e-72 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10041879 [exp] 213 / 6e-72 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10016436 [exp] 175 / 7e-57 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 173 / 3e-56 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 160 / 3e-51 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 160 / 4e-51 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 160 / 6e-51 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 156 / 2e-49 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G175400 [exp] 261 / 6e-91 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 250 / 1e-86 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 181 / 4e-59 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.009G135201 [exp] 169 / 3e-55 AT4G38580 167 / 8e-55 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.007G087300 [exp] 165 / 4e-53 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 163 / 2e-52 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 157 / 5e-50 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 152 / 6e-48 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 149 / 8e-47 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G092200 [exp] 147 / 4e-46 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10019789 pacid=23163980 polypeptide=Lus10019789 locus=Lus10019789.g ID=Lus10019789.BGIv1.0 annot-version=v1.0 ATGGGCGTAGTGGATAATTTCTCCCACCTCTTCGACTGCTCAAGCCGAAGCTCTCACAAAAGACGCAAGCAACTCCAGACCGTGGAGATCAAGGTGAGGA TAGACTGCGAGGGGTGCGAGCGGAAGGTGAAGAGGGCGGTGGAAGGGATGAAAGGCGTCAGCAAAGTCGACGTCGAGCGCAAGGCCAACAAGGTCACCGT CACGGGCTACGTGGACCCTTCCAAGGTGATCGCCCGCGTGGCTCACAGGACGGGGAAGAGAGCTGAGCCGTGGCCGTACGTGCCATACGACGTCGTGGCG CACCCTTACGCTGCTGGGGTTTATGACAAGAAGGCTCCTTCGGGTTACGTGCGGAGGGCGGATGACCCGGGTGTTTATCAGCTCGCACGTGCCAGCTCCA CGGAGGTGAGGTACACCACCGCGTTTAGCGACGATAACCCGGCTGCTTGTTCCGTCATGTGA
AA sequence Show only first row Show all	>Lus10019789 pacid=23163980 polypeptide=Lus10019789 locus=Lus10019789.g ID=Lus10019789.BGIv1.0 annot-version=v1.0 MGVVDNFSHLFDCSSRSSHKRRKQLQTVEIKVRIDCEGCERKVKRAVEGMKGVSKVDVERKANKVTVTGYVDPSKVIARVAHRTGKRAEPWPYVPYDVVA HPYAAGVYDKKAPSGYVRRADDPGVYQLARASSTEVRYTTAFSDDNPAACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10019789 [exp]	0	1
AT2G30210		LAC3	laccase 3 (.1)		Lus10026400 [exp]	1.0	0.7831
AT2G31081		CLE4	CLAVATA3/ESR-RELATED 4 (.1)		Lus10015304 [exp]	8.4	0.7559
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10023979 [exp]	11.7	0.7426
AT5G48670	MADS	FEM111, AGL80	AGAMOUS-like 80 (.1)		Lus10014883 [exp]	14.1	0.6194
AT5G52790			CBS domain-containing protein ...		Lus10027527 [exp]	18.4	0.6986
AT5G19640			Major facilitator superfamily ...		Lus10013736 [exp]	27.0	0.6494
AT1G17615			Disease resistance protein (TI...		Lus10005374 [exp]	34.6	0.6334
AT5G55840			Pentatricopeptide repeat (PPR)...		Lus10038697 [exp]	42.4	0.6650
					Lus10002730 [exp]	52.3	0.6569
AT1G04220		KCS2	3-ketoacyl-CoA synthase 2 (.1)		Lus10006636 [exp]	62.0	0.6965

Compare expression of checked genes

Lus10019789 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.