Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35070 170 / 1e-53 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT3G12920 109 / 1e-28 BRG3 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) AT1G45976 105 / 3e-27 SBP1 S-ribonuclease binding protein 1 (.1) AT1G79110 101 / 2e-25 BRG2 BOI-related gene 2, zinc ion binding (.1.2) AT4G19700 95 / 1e-23 BOI, RING Botrytis Susceptible1 Interactor, SBP (S-ribonuclease binding protein) family protein (.1) AT5G45100 94 / 2e-23 BRG1 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G32740 91 / 1e-21 SBP (S-ribonuclease binding protein) family protein (.1) AT1G60610 90 / 2e-21 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2), SBP (S-ribonuclease binding protein) family protein (.3) AT5G47050 88 / 7e-21 SBP (S-ribonuclease binding protein) family protein (.1) AT1G10650 87 / 9e-21 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014118 [exp] 391 / 8e-141 AT4G35070 171 / 7e-54 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10017276 [exp] 150 / 1e-45 AT4G35070 122 / 2e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10013569 [exp] 149 / 4e-44 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10031780 [exp] 107 / 6e-28 AT3G12920 260 / 3e-85 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10013027 [exp] 98 / 2e-24 AT1G10650 382 / 3e-133 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10001131 [exp] 98 / 2e-24 AT1G45976 407 / 7e-143 S-ribonuclease binding protein 1 (.1) Lus10030891 [exp] 95 / 1e-23 AT1G10650 275 / 1e-92 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10031202 [exp] 95 / 4e-23 AT3G12920 255 / 3e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10030599 [exp] 94 / 8e-23 AT1G10650 380 / 4e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G175500 [exp] 236 / 1e-78 AT4G35070 142 / 1e-41 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.009G135400 [exp] 224 / 6e-74 AT4G35070 135 / 6e-39 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G019000 [exp] 184 / 5e-58 AT4G35070 148 / 6e-43 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.005G242600 [exp] 170 / 6e-53 AT4G35070 135 / 3e-38 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.001G439600 [exp] 106 / 2e-27 AT3G12920 256 / 1e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Potri.001G148600 [exp] 102 / 4e-26 AT1G32740 221 / 4e-70 SBP (S-ribonuclease binding protein) family protein (.1) Potri.015G118000 [exp] 102 / 5e-26 AT5G45100 259 / 2e-85 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.014G027000 [exp] 102 / 6e-26 AT1G45976 380 / 2e-132 S-ribonuclease binding protein 1 (.1) Potri.012G082200 [exp] 101 / 7e-26 AT1G10650 266 / 2e-87 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.003G085800 [exp] 100 / 3e-25 AT1G32740 220 / 9e-70 SBP (S-ribonuclease binding protein) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019790 pacid=23164082 polypeptide=Lus10019790 locus=Lus10019790.g ID=Lus10019790.BGIv1.0 annot-version=v1.0 ATGGTGGTGAACCCTTCTCTTCAATCCATGGCCGCTTTTGAGCAGAAGCAGAGGCAAGAAATCGACCACTACATCAGATTGCAGAACGAGAGGTTGAGGG TGATGCTGCAAGAACAGAGGAAGCAACAGCTCGCCGTGCTACTAAAATCAATCGAGTCAAAGGCGACGGTCCTCCTACAGCAAAAGGACGACGAAATATC GCTGGTGACGAAGCGAGCGACGGAGATGGAACTCGTGATGAACCGCCTGGAAATGGAGAACCAAGCGTGGCAGAGGATCGCGAAGGAGAACGAAGCGGCG GTGATCTCGCTCAACAACACTCTGGAACAAGTCAGGGAGAGCTCCTCGCTAATGATGATGGTTAATCACAACAACGGGGAAGGAGACGCAGAGTCGTGCT GTTCCGGTAACGACGTTAATAACAAAACGGACGCGGCGGCGGGACGGGTGTGTAAAGGGTGCAATTCTAGGGGAGCGTGCGTATTGTTCTTGCCGTGCAG GCATCTCTGTTCATGCAACGTCTGTGAAGGGTTTCTGGACAGCTGCCCTGTCTGTCGTACGCCGAAGAAAGCCAGCATTGAGGCATTAATGGGCTGA
AA sequence Show only first row Show all	>Lus10019790 pacid=23164082 polypeptide=Lus10019790 locus=Lus10019790.g ID=Lus10019790.BGIv1.0 annot-version=v1.0 MVVNPSLQSMAAFEQKQRQEIDHYIRLQNERLRVMLQEQRKQQLAVLLKSIESKATVLLQQKDDEISLVTKRATEMELVMNRLEMENQAWQRIAKENEAA VISLNNTLEQVRESSSLMMMVNHNNGEGDAESCCSGNDVNNKTDAAAGRVCKGCNSRGACVLFLPCRHLCSCNVCEGFLDSCPVCRTPKKASIEALMG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35070			SBP (S-ribonuclease binding pr...		Lus10019790 [exp]	0	1
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10030927 [exp]	9.6	0.9277
AT5G36930			Disease resistance protein (TI...		Lus10014671 [exp]	10.7	0.9355
AT4G25770			alpha/beta-Hydrolases superfam...		Lus10006982 [exp]	11.5	0.9296
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10027585 [exp]	11.8	0.9270
AT4G14410	bHLH	bHLH104	basic Helix-Loop-Helix 104, ba...		Lus10041148 [exp]	16.3	0.9202
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10014086 [exp]	18.9	0.9151
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10008881 [exp]	19.9	0.9229
AT2G31945			unknown protein		Lus10013740 [exp]	27.5	0.9231
AT3G49180		RID3	ROOT INITIATION DEFECTIVE 3, T...		Lus10025732 [exp]	27.9	0.9246
AT5G52430			hydroxyproline-rich glycoprote...		Lus10024642 [exp]	28.2	0.9270

Compare expression of checked genes

Lus10019790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.