Lus10019804 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 179 / 4e-57 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 157 / 2e-48 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
AT2G15170 38 / 0.0007 Plant basic secretory protein (BSP) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014107 312 / 1e-108 AT2G15220 222 / 2e-72 Plant basic secretory protein (BSP) family protein (.1)
Lus10019805 251 / 1e-85 AT2G15220 213 / 8e-70 Plant basic secretory protein (BSP) family protein (.1)
Lus10019803 197 / 7e-64 AT2G15220 231 / 4e-77 Plant basic secretory protein (BSP) family protein (.1)
Lus10019806 183 / 2e-58 AT2G15220 279 / 8e-96 Plant basic secretory protein (BSP) family protein (.1)
Lus10014106 161 / 6e-50 AT2G15220 230 / 2e-76 Plant basic secretory protein (BSP) family protein (.1)
Lus10019807 157 / 5e-48 AT2G15220 229 / 5e-76 Plant basic secretory protein (BSP) family protein (.1)
Lus10013868 149 / 3e-45 AT2G15220 217 / 3e-71 Plant basic secretory protein (BSP) family protein (.1)
Lus10013863 147 / 2e-44 AT2G15220 224 / 9e-74 Plant basic secretory protein (BSP) family protein (.1)
Lus10026579 147 / 2e-44 AT2G15220 226 / 1e-74 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 193 / 1e-62 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 189 / 5e-61 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 182 / 3e-58 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 181 / 1e-57 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 159 / 4e-49 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.005G202300 48 / 1e-06 AT2G42900 134 / 2e-37 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10019804 pacid=23163959 polypeptide=Lus10019804 locus=Lus10019804.g ID=Lus10019804.BGIv1.0 annot-version=v1.0
ATGTCATCCGCCACGTCATTCATATGGCAGACCTTCCAACAGTCTGGTCCCCCAAAGGACATCGACACGGTGGGGTTGTCCATCGAGGACATGGGCGGAG
TGGCATACACGACGATCCCGGGGTACGTGATCCACGTCAGCGCAGGGTACATCGGGAGTTACGAGGGGGACGTGGAGGAGGAGTTCAAAGGCGTGGTGTC
CCACGAGATGACGCACGTGTGGCAGTGGTTCGGGAACGGGCAGGCTCCGAGTTGGTTGATCGAAGGGATTGCGGATTACGTGAGGCTGAAGGCTAATCTC
CCCGGGAAGAACTGGGTGGGGCCCGGGGAAGGTGACCGGTGGGACCAAGGGTATTCTGTTACGGCCAGGTTTTTGGATTACATTGGCGGGTTGAAGAGTG
GGTTTGTTGCTGAGTTGAATGAGATGATGAAGGACGGGTATAGTGATGACTTTTTTCAGGTGTTGACCGTTACTGCCAACAAAACAAACTCCAAAATCCA
CCGTGAACATCATCAAATCCTGAACCAGGGGCATTACACAAACCCAAACCCTAATCGAAGATCAAACTAA
AA sequence
>Lus10019804 pacid=23163959 polypeptide=Lus10019804 locus=Lus10019804.g ID=Lus10019804.BGIv1.0 annot-version=v1.0
MSSATSFIWQTFQQSGPPKDIDTVGLSIEDMGGVAYTTIPGYVIHVSAGYIGSYEGDVEEEFKGVVSHEMTHVWQWFGNGQAPSWLIEGIADYVRLKANL
PGKNWVGPGEGDRWDQGYSVTARFLDYIGGLKSGFVAELNEMMKDGYSDDFFQVLTVTANKTNSKIHREHHQILNQGHYTNPNPNRRSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10019804 0 1
AT1G31720 Protein of unknown function (D... Lus10034746 1.0 0.9712
AT1G48820 Terpenoid cyclases/Protein pre... Lus10008613 2.0 0.9106
AT3G19950 RING/U-box superfamily protein... Lus10033682 3.5 0.8851
AT5G46030 unknown protein Lus10014995 5.3 0.8889
AT5G13530 KEG KEEP ON GOING, protein kinases... Lus10020272 5.9 0.8888
AT5G43500 ATARP9 actin-related protein 9 (.1.2) Lus10021206 7.9 0.8757
AT3G11660 NHL1 NDR1/HIN1-like 1 (.1) Lus10013327 13.7 0.8552
AT2G27410 B3 Domain of unknown function (DU... Lus10027286 13.7 0.9026
AT1G77760 GNR1, NIA1 nitrate reductase 1 (.1) Lus10031005 14.1 0.7867
AT2G43570 CHI "chitinase, putative", chitina... Lus10014253 23.9 0.7014

Lus10019804 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.