Lus10019812 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19460 179 / 4e-57 Reticulon family protein (.1.2)
AT2G15280 164 / 3e-51 Reticulon family protein (.1.2)
AT4G23630 119 / 1e-32 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
AT4G11220 116 / 1e-31 RTNLB2, BTI2 Reticulan like protein B2, VIRB2-interacting protein 2 (.1)
AT1G64090 115 / 1e-31 RTNLB3 Reticulan like protein B3 (.1.2)
AT2G46170 111 / 6e-30 Reticulon family protein (.1.2)
AT3G10915 109 / 1e-29 Reticulon family protein (.1.2.3.4.5.6)
AT3G54120 107 / 5e-29 Reticulon family protein (.1)
AT5G41600 108 / 1e-28 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
AT3G61560 107 / 1e-28 Reticulon family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014102 328 / 1e-115 AT3G19460 209 / 5e-69 Reticulon family protein (.1.2)
Lus10027867 221 / 3e-73 AT3G19460 184 / 1e-58 Reticulon family protein (.1.2)
Lus10002815 219 / 1e-72 AT3G19460 188 / 1e-60 Reticulon family protein (.1.2)
Lus10038833 117 / 2e-32 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
Lus10028753 123 / 3e-32 AT5G35360 888 / 0.0 acetyl Co-enzyme a carboxylase biotin carboxylase subunit (.1.2.3)
Lus10014948 117 / 5e-32 AT4G23630 306 / 3e-105 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Lus10027548 115 / 3e-31 AT1G64090 316 / 2e-109 Reticulan like protein B3 (.1.2)
Lus10017533 112 / 4e-30 AT1G64090 303 / 9e-104 Reticulan like protein B3 (.1.2)
Lus10032313 110 / 2e-29 AT4G23630 318 / 1e-109 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G300400 226 / 3e-75 AT3G19460 145 / 8e-44 Reticulon family protein (.1.2)
Potri.009G096200 178 / 1e-56 AT2G15280 132 / 1e-38 Reticulon family protein (.1.2)
Potri.015G027300 124 / 7e-35 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.016G110200 120 / 5e-34 AT3G54120 193 / 1e-62 Reticulon family protein (.1)
Potri.014G091200 120 / 2e-33 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2)
Potri.012G035600 116 / 7e-32 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.001G097700 111 / 5e-30 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.003G133600 110 / 1e-29 AT4G23630 284 / 8e-97 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.002G165400 107 / 1e-28 AT2G46170 311 / 1e-107 Reticulon family protein (.1.2)
Potri.002G055600 105 / 6e-28 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0484 Peroxisome PF02453 Reticulon Reticulon
Representative CDS sequence
>Lus10019812 pacid=23163941 polypeptide=Lus10019812 locus=Lus10019812.g ID=Lus10019812.BGIv1.0 annot-version=v1.0
ATGGAAGGTAGCTCCGACAGTACATTCCCTCATCCTCGTCGCATATCCGTCCACCGGCTGCTTGGCGGGGGTTCAGTTGCCGATGTGCTGCTGTGGCGGA
GATTGGGCGGCAGCTTGACGTTGTTATTGGCTTCGACGATTGCGTGGATTCTGTTCGAGATAGCAGATTACAGTCTGCTGACGTTCGTGGCGAATGTGTT
GTTCCTCCTCGTCGCAATTCTCTTCCTATGGGCGAAATCTGCTTCTCTTCTCAATCGGCCACTGCCGCCAATTCCTGATCTGGAAATAACTGAGGAGACC
ATTGACAAGGTTGCTCAAGTTCTTCAAGTTTATGTCAACCGTGTATTAGCAATTGGTTCTGACATCGCAATCGGAAGAAATTCGAAAGTTTTCTTACAGG
TCGCTTTTACATTGTGGATCGTTTCTTATCTCGGTAGCCTCTGCGGTTTCCTTACTTTAGTGTACCTTGGGATTCTTCTCAGTCTTTCGATCCCGGTGCT
TTATGACAAATACCAGCACCAGGTTGATGAAAATCTTCTTGTAGCACAGACAATTCTTGAAGCTCAGCTTAGGAAAATTGATCATCTTCTGAAGAAAGCT
CCACTGCCATCAAACAAGGAAAAGAAGGTTCAATAG
AA sequence
>Lus10019812 pacid=23163941 polypeptide=Lus10019812 locus=Lus10019812.g ID=Lus10019812.BGIv1.0 annot-version=v1.0
MEGSSDSTFPHPRRISVHRLLGGGSVADVLLWRRLGGSLTLLLASTIAWILFEIADYSLLTFVANVLFLLVAILFLWAKSASLLNRPLPPIPDLEITEET
IDKVAQVLQVYVNRVLAIGSDIAIGRNSKVFLQVAFTLWIVSYLGSLCGFLTLVYLGILLSLSIPVLYDKYQHQVDENLLVAQTILEAQLRKIDHLLKKA
PLPSNKEKKVQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19460 Reticulon family protein (.1.2... Lus10019812 0 1
AT3G26980 MUB4 membrane-anchored ubiquitin-fo... Lus10035184 1.0 0.9053
AT1G12400 Nucleotide excision repair, TF... Lus10006998 1.4 0.8895
AT1G14300 ARM repeat superfamily protein... Lus10036742 3.2 0.8724
AT1G66510 AAR2 protein family (.1.2.3) Lus10028528 4.5 0.8561
Lus10007667 5.0 0.8810
AT5G03430 phosphoadenosine phosphosulfat... Lus10026539 6.6 0.8707
AT3G13970 APG12B, APG12 AUTOPHAGY 12 B, AUTOPHAGY 12, ... Lus10000432 10.6 0.8798
AT5G22080 Chaperone DnaJ-domain superfam... Lus10004099 10.8 0.8818
AT2G35795 Chaperone DnaJ-domain superfam... Lus10041420 11.5 0.8551
AT1G12390 Cornichon family protein (.1) Lus10009295 12.0 0.8470

Lus10019812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.