Lus10019813 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014101 349 / 3e-125 ND /
Lus10019815 340 / 1e-121 ND /
Lus10014099 339 / 2e-121 ND /
Lus10028949 309 / 3e-109 ND /
Lus10024445 228 / 2e-77 ND /
Lus10037860 221 / 3e-74 ND /
Lus10000191 206 / 3e-68 ND /
Lus10039879 205 / 7e-68 ND /
Lus10029851 204 / 1e-67 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G081800 279 / 3e-97 ND /
Potri.002G158600 276 / 3e-96 ND /
Potri.002G158700 271 / 2e-94 ND /
Potri.014G082700 267 / 2e-92 ND /
Potri.019G100100 263 / 7e-91 ND /
Potri.014G081900 256 / 2e-88 ND /
Potri.014G082000 229 / 2e-77 ND /
Potri.003G126200 221 / 2e-74 ND /
Potri.017G153100 149 / 1e-45 ND /
Potri.003G126400 136 / 1e-41 ND /
PFAM info
Representative CDS sequence
>Lus10019813 pacid=23164069 polypeptide=Lus10019813 locus=Lus10019813.g ID=Lus10019813.BGIv1.0 annot-version=v1.0
ATGGCCGCGAAGATCGAGGCACAGAGCTGCAAGCCGAGTGGTTACATAACGGGGATCACTCCACCACCAGGGCAATGCAACCAGGGAGAAGAATCCGACT
GTTGCAAGGCAGGCAAGCATTACACCACTTACAAATGTTCACCCCCTGTGACTGGCCGAACCAAGGCGACTCTGACTTGGAACAGCTTTGAGAAAGGAGG
GAGTGGAGGTGGGCCATCTGAGTGCGATAACCAGTACCACCCCAATGATCATCCAGTGGTAGCGTTGTCGACTGGATGGTTCAATAACAAGAGCAGGTGT
CTCAACTTTATAAACATCCACGGGAATGGGAAAACTGTTAGGGCAATGGTCGTAGACGAGTGCGACTCTACCATGGGGTGTGATTCTGACCATGATTATC
AACCTCCTTGTCCTGACAACATTGTTGATGCATCGAAAGCGGTTTGGAAAGCGTTGGGGGTGCCCGAAGATAATTGGGGTGATCTGGATATCACCTGGTC
CGATGCTTGA
AA sequence
>Lus10019813 pacid=23164069 polypeptide=Lus10019813 locus=Lus10019813.g ID=Lus10019813.BGIv1.0 annot-version=v1.0
MAAKIEAQSCKPSGYITGITPPPGQCNQGEESDCCKAGKHYTTYKCSPPVTGRTKATLTWNSFEKGGSGGGPSECDNQYHPNDHPVVALSTGWFNNKSRC
LNFINIHGNGKTVRAMVVDECDSTMGCDSDHDYQPPCPDNIVDASKAVWKALGVPEDNWGDLDITWSDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10019813 0 1
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Lus10039300 10.5 0.8460
AT3G62710 Glycosyl hydrolase family prot... Lus10034128 24.1 0.7194
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10039454 25.5 0.8176
AT4G30030 Eukaryotic aspartyl protease f... Lus10031450 31.5 0.7915
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10006704 33.1 0.6865
AT2G24840 MADS DIA, AGL61 DIANA, AGAMOUS-like 61 (.1) Lus10030663 34.8 0.8100
AT1G11410 S-locus lectin protein kinase ... Lus10007610 44.3 0.7370
AT1G62510 Bifunctional inhibitor/lipid-t... Lus10001493 55.0 0.7561
AT5G46050 ATPTR3, PTR3 ARABIDOPSIS THALIANA PEPTIDE T... Lus10022892 56.9 0.7930
AT4G27290 S-locus lectin protein kinase ... Lus10034815 58.5 0.7540

Lus10019813 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.