Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35220 111 / 2e-31 Cyclase family protein (.1) AT4G34180 103 / 2e-28 Cyclase family protein (.1) AT1G44542 100 / 5e-27 Cyclase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014091 [exp] 139 / 1e-42 AT1G44542 333 / 3e-116 Cyclase family protein (.1) Lus10027872 [exp] 114 / 3e-33 AT4G35220 310 / 8e-108 Cyclase family protein (.1) Lus10014092 [exp] 116 / 5e-32 AT4G35220 366 / 3e-125 Cyclase family protein (.1) Lus10001508 [exp] 102 / 8e-28 AT4G34180 281 / 2e-95 Cyclase family protein (.1) Lus10031454 [exp] 102 / 9e-28 AT4G34180 274 / 1e-92 Cyclase family protein (.1) Lus10001509 [exp] 99 / 9e-27 AT4G34180 268 / 8e-91 Cyclase family protein (.1) Lus10019822 [exp] 98 / 3e-26 AT4G35220 396 / 1e-140 Cyclase family protein (.1) Lus10031453 [exp] 98 / 4e-26 AT4G34180 278 / 4e-94 Cyclase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G097300 [exp] 110 / 2e-31 AT4G35220 343 / 6e-120 Cyclase family protein (.1) Potri.001G301501 [exp] 105 / 2e-29 AT4G35220 397 / 4e-141 Cyclase family protein (.1) Potri.001G301600 [exp] 104 / 7e-29 AT4G35220 363 / 1e-127 Cyclase family protein (.1) Potri.009G097201 [exp] 102 / 8e-29 AT4G35220 291 / 1e-100 Cyclase family protein (.1) Potri.001G301700 [exp] 98 / 2e-26 AT4G35220 348 / 1e-121 Cyclase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019823 pacid=23163939 polypeptide=Lus10019823 locus=Lus10019823.g ID=Lus10019823.BGIv1.0 annot-version=v1.0 ATGCTCAACACTAACATAACAACGAGTAAAATTGAATTTTTAACTTCATTTGACCATTTTTTAAAAGACATCAATCTTGTTGGAGTTGATTATTTATCTG CAATTGCTTTTGTCAATACTGCCCCAACTCATCTTGCTTTCCTAAAGAACAGGGACATCATTCTCATCGAAGCAATCAAACTCGATAACGTTGAAGCTGG ACTATACAATGTTCATTGCTTACCCCTGAGGCTGGTCGGAGCTGAGGGATCACCGGCACGATGCATTCTCATCAAATGA
AA sequence Show only first row Show all	>Lus10019823 pacid=23163939 polypeptide=Lus10019823 locus=Lus10019823.g ID=Lus10019823.BGIv1.0 annot-version=v1.0 MLNTNITTSKIEFLTSFDHFLKDINLVGVDYLSAIAFVNTAPTHLAFLKNRDIILIEAIKLDNVEAGLYNVHCLPLRLVGAEGSPARCILIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G35220			Cyclase family protein (.1)		Lus10019823 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10000843 [exp]	4.7	1.0000
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10001774 [exp]	6.7	1.0000
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10007220 [exp]	9.2	0.9999
					Lus10001326 [exp]	9.6	1.0000
AT2G33470		ATGLTP1, GLTP1	ARABIDOPSIS GLYCOLIPID TRANSFE...		Lus10008244 [exp]	11.0	1.0000
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10009736 [exp]	11.8	1.0000
AT1G07985			Expressed protein (.1)		Lus10029516 [exp]	12.0	1.0000
					Lus10022529 [exp]	12.0	1.0000
AT2G36780			UDP-Glycosyltransferase superf...		Lus10022628 [exp]	12.2	1.0000
AT3G57030			Calcium-dependent phosphotries...		Lus10009015 [exp]	12.2	1.0000

Compare expression of checked genes

Lus10019823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.