Lus10019827 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43060 488 / 2e-172 Granulin repeat cysteine protease family protein (.1)
AT1G47128 473 / 1e-166 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
AT3G19390 464 / 6e-163 Granulin repeat cysteine protease family protein (.1)
AT4G36880 361 / 8e-124 CP1 cysteine proteinase1 (.1)
AT1G09850 350 / 2e-118 XBCP3 xylem bark cysteine peptidase 3 (.1)
AT3G19400 322 / 1e-108 Cysteine proteinases superfamily protein (.1.2)
AT5G50260 320 / 9e-108 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
AT3G48340 316 / 2e-106 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1)
AT4G35350 316 / 3e-106 XCP1 xylem cysteine peptidase 1 (.1.2)
AT1G20850 301 / 2e-100 XCP2 xylem cysteine peptidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014087 656 / 0 AT5G43060 622 / 0.0 Granulin repeat cysteine protease family protein (.1)
Lus10002827 583 / 0 AT1G47128 609 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Lus10027877 583 / 0 AT5G43060 597 / 0.0 Granulin repeat cysteine protease family protein (.1)
Lus10024801 471 / 9e-166 AT1G47128 633 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Lus10006130 339 / 3e-114 AT1G09850 535 / 0.0 xylem bark cysteine peptidase 3 (.1)
Lus10018735 330 / 9e-111 AT1G47128 491 / 3e-172 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Lus10018083 315 / 7e-106 AT5G50260 533 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10042078 313 / 6e-105 AT5G50260 538 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Lus10013674 311 / 4e-104 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G302100 545 / 0 AT1G47128 598 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Potri.009G098100 536 / 0 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1)
Potri.014G024100 480 / 3e-169 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1)
Potri.007G047600 357 / 6e-122 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1)
Potri.005G232900 347 / 2e-117 AT1G09850 594 / 0.0 xylem bark cysteine peptidase 3 (.1)
Potri.005G141600 344 / 4e-117 AT4G36880 437 / 1e-153 cysteine proteinase1 (.1)
Potri.012G090900 321 / 4e-108 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.015G087400 318 / 5e-107 AT5G50260 550 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Potri.004G207600 315 / 3e-106 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2)
Potri.015G087500 314 / 2e-105 AT5G50260 530 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
CL0125 PF00396 Granulin Granulin
Representative CDS sequence
>Lus10019827 pacid=23164032 polypeptide=Lus10019827 locus=Lus10019827.g ID=Lus10019827.BGIv1.0 annot-version=v1.0
ATGGACAGGTCGAAGAAGGTCAACAGTTCTTCTTCGTCGCCGGCGGTTGGCGAGAGGTATTTGTTTAAGAAGGGCGATGACTTGCCGGCTAGCGTCGATT
GGCGCGAGAAAGGAGCTGTTGCCCCGGTCAAAGATCAAGGACAGTGCGGGAGCTGCTGGGCTTTCTCAACTGTGGGAGCTGTAGAAGGAATCAACCAAAT
TGTTACTGGTGAGATGATTTCACTGTCTGAACAGGAGCTTGTGGATTGCGATACCTCATATAACCAAGGTTGCAATGGAGGTCTCATGGACTATGCATTT
GAGTTCATCATGAAGAATGGCGGTATTGATACCGAAGATGATTACCCTTACAAGGCTGCTGATGATGTCTGTGATTCCAACAGGAAAAATGCCAAGGTTG
TTATCATTGATGGGTACGAGGATGTTCCACAAAACGACGAGAGTTCCCTGAAGAAGGCTGTGGCAGGTCAGCCAGTCAGTGTCGCCATTGAAGCTGGTGG
CAGGGCGTTCCAGCTCTACCAGTCGGGTGTTTTCACTGGTCAATGCGGGACACAACTCGACCATGGTGTCGTTGCAGTTGGATACGGGACTGAGAATGGT
GTCGACTACTGGATCGTGAGGAACTCGTGGGGACCAGAGTGGGGAGAGAAAGGGTACATCAAGATGGAGCGTAATGTTGCCAAGACCAAGACAGGGAAGT
GTGGAATTGCGATGCAAGCTTCATACCCAACCAAGAAGGGACCAAACCCTCCTAACCCAGGTCCAACTCCACCAACCCCGGCTACTCCCCCACCTCCACC
GAGCCCTGGATCTGTATGCGACGACTACTACTCATGTCCCGCAAGCACCACTTGCTGCTGCATTTATCAATACGATAACTACTGCTTTGGATGGGGATGC
TGCCCTCTCGAATCTGCAACTTGCTGCGATGACCACTACAGTTGCTGCCCTCATGACTATCCAGTCTGTGACCTCAACGCTGGAACCTGCAGAATGAGCA
AGGAGAATCCGTTTGGAGTGGCGACGATGAAGCGATTCCTGGCTAAAAGCACTAGGCCTCAGTTGCAGAGGGTGGTTGTTACCGCCGCTTGA
AA sequence
>Lus10019827 pacid=23164032 polypeptide=Lus10019827 locus=Lus10019827.g ID=Lus10019827.BGIv1.0 annot-version=v1.0
MDRSKKVNSSSSSPAVGERYLFKKGDDLPASVDWREKGAVAPVKDQGQCGSCWAFSTVGAVEGINQIVTGEMISLSEQELVDCDTSYNQGCNGGLMDYAF
EFIMKNGGIDTEDDYPYKAADDVCDSNRKNAKVVIIDGYEDVPQNDESSLKKAVAGQPVSVAIEAGGRAFQLYQSGVFTGQCGTQLDHGVVAVGYGTENG
VDYWIVRNSWGPEWGEKGYIKMERNVAKTKTGKCGIAMQASYPTKKGPNPPNPGPTPPTPATPPPPPSPGSVCDDYYSCPASTTCCCIYQYDNYCFGWGC
CPLESATCCDDHYSCCPHDYPVCDLNAGTCRMSKENPFGVATMKRFLAKSTRPQLQRVVVTAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43060 Granulin repeat cysteine prote... Lus10019827 0 1
AT1G47128 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A,... Lus10019828 4.2 0.8283
AT5G45030 Trypsin family protein (.1.2) Lus10031205 4.8 0.8506
AT2G17990 unknown protein Lus10028465 7.3 0.8108
AT4G16330 2-oxoglutarate (2OG) and Fe(II... Lus10037292 18.1 0.8472
AT4G02590 bHLH bHLH059, UNE12 unfertilized embryo sac 12, ba... Lus10006587 20.6 0.7918
AT1G13700 PGL1 6-phosphogluconolactonase 1 (.... Lus10036919 25.3 0.7842
AT4G16210 ECHIA, E-COAH-2 ENOYL-COA HYDRATASE 2, enoyl-C... Lus10016919 29.7 0.8319
AT1G12910 LWD1, ATAN11 LIGHT-REGULATED WD 1, ANTHOCYA... Lus10012593 33.3 0.8370
AT5G53460 GLT1 NADH-dependent glutamate synth... Lus10019020 37.1 0.8186
AT2G23060 Acyl-CoA N-acyltransferases (N... Lus10025191 48.0 0.7368

Lus10019827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.