Lus10019829 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36780 135 / 8e-37 UDP-Glycosyltransferase superfamily protein (.1)
AT4G34135 126 / 1e-34 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2)
AT2G15490 124 / 6e-33 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3)
AT4G34131 124 / 7e-33 UGT73B3 UDP-glucosyl transferase 73B3 (.1)
AT2G36770 124 / 9e-33 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36800 122 / 7e-32 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1)
AT2G36750 120 / 2e-31 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1)
AT2G15480 118 / 1e-30 UGT73B5 UDP-glucosyl transferase 73B5 (.1.2)
AT4G34138 118 / 2e-30 UGT73B1 UDP-glucosyl transferase 73B1 (.1)
AT2G36760 116 / 5e-30 UGT73C2 UDP-glucosyl transferase 73C2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014086 309 / 9e-104 AT2G15490 496 / 4e-173 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10019832 241 / 3e-77 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014083 239 / 2e-76 AT4G34131 489 / 2e-170 UDP-glucosyl transferase 73B3 (.1)
Lus10019831 167 / 7e-49 AT2G15490 425 / 8e-146 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10014084 160 / 2e-46 AT2G15490 445 / 2e-153 UDP-glycosyltransferase 73B4 (.1.2.3)
Lus10019833 140 / 5e-39 AT2G15480 483 / 2e-168 UDP-glucosyl transferase 73B5 (.1.2)
Lus10014082 138 / 5e-38 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2)
Lus10014079 128 / 3e-34 AT4G34131 483 / 3e-168 UDP-glucosyl transferase 73B3 (.1)
Lus10014080 114 / 4e-30 AT2G15480 330 / 3e-110 UDP-glucosyl transferase 73B5 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G302400 172 / 1e-50 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.009G098400 167 / 1e-48 AT2G15490 505 / 8e-177 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.001G302300 159 / 1e-45 AT4G34131 488 / 4e-170 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303600 156 / 7e-45 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.009G098966 155 / 2e-44 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303000 153 / 1e-43 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303700 150 / 9e-43 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G303300 149 / 4e-42 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.009G099032 142 / 1e-39 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3)
Potri.002G123700 135 / 8e-37 AT4G34131 446 / 3e-153 UDP-glucosyl transferase 73B3 (.1)
PFAM info
Representative CDS sequence
>Lus10019829 pacid=23163947 polypeptide=Lus10019829 locus=Lus10019829.g ID=Lus10019829.BGIv1.0 annot-version=v1.0
ATGCATTGTTTCACACGTCAAGAGCCTTGGAAGGGTGTTGAATCTGATTCCGAGGCATTTGTGATGCCTGGTTTACCCCACCGGATTGAGTTCCCCAAGT
TGCAACTTCCTCCTTTCTGGAAAGGTGAGGGGATTACTGAAGAATGGCTAGAAATGAGAGATCTGATAAACGAATCGGAGGAGAAGAGCTTCGGAGCTGT
GGTGAATAGCTTCCACGAGCTCCAGCCTGGGTACTCCGAGCATTACAGGGAGGTTATAGAGAGAAAGGCATGGTTCATTGGTCCACTGTCGCTCGGTAAC
AAAGACAGTACCTTGGAGAAAGCAGAAAGAATGAAAACGGCAGCAATTGATGGACACGAATGTTTAAGATGGCTAGACTGTAGAGAAGAACCCAATTCGG
TTCTCTACATTTGTTTCGGGAGCATGTCTGATATTCCGGATGCTCAGCTTTTCGAGATTGCATCAGCTCTCGAGGCATCAGGGTTGGTGACGGATGTTCT
GAGGTTTGGGGTTGGGATTGGGTCTCGGGAATGGTCGAGGAACGATAGGGAGATCATGGTTGGTGAACATGCTGAAGAAATGAGAGAGCGAGCTATGGAG
CTTAAGGTAAAGGCTATGAAGGCTAATGAAGAAGGGGGATCGTCTTACTCTGATTTGAAATCATTGTTGGAGGAGCTTGTATCTGTAAGAGACAAGAAGG
ATGTTGATTTGTCAAGCTGCAAACTGTAA
AA sequence
>Lus10019829 pacid=23163947 polypeptide=Lus10019829 locus=Lus10019829.g ID=Lus10019829.BGIv1.0 annot-version=v1.0
MHCFTRQEPWKGVESDSEAFVMPGLPHRIEFPKLQLPPFWKGEGITEEWLEMRDLINESEEKSFGAVVNSFHELQPGYSEHYREVIERKAWFIGPLSLGN
KDSTLEKAERMKTAAIDGHECLRWLDCREEPNSVLYICFGSMSDIPDAQLFEIASALEASGLVTDVLRFGVGIGSREWSRNDREIMVGEHAEEMRERAME
LKVKAMKANEEGGSSYSDLKSLLEELVSVRDKKDVDLSSCKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15490 UGT73B4 UDP-glycosyltransferase 73B4 (... Lus10019829 0 1
AT1G66930 Protein kinase superfamily pro... Lus10022367 3.2 0.8548
AT2G31140 Peptidase S24/S26A/S26B/S26C f... Lus10022921 3.6 0.8601
AT1G15360 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integr... Lus10009480 13.0 0.8538
AT3G62390 TBL6 TRICHOME BIREFRINGENCE-LIKE 6 ... Lus10017671 16.9 0.7613
AT3G23100 XRCC4 homolog of human DNA ligase iv... Lus10022210 19.0 0.8212
AT5G56670 Ribosomal protein S30 family p... Lus10028808 19.2 0.7996
AT3G25940 TFIIB zinc-binding protein (.1... Lus10015458 19.7 0.8517
AT1G76860 Small nuclear ribonucleoprotei... Lus10026326 21.0 0.8186
AT5G62140 unknown protein Lus10038887 22.2 0.8171
AT3G15150 HPY2, ATMMS21 HIGH PLOIDY2, A. THALIANA METH... Lus10015968 26.7 0.8307

Lus10019829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.