Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15490 42 / 1e-05 UGT73B4 UDP-glycosyltransferase 73B4 (.1.2.3) AT5G38040 40 / 6e-05 UDP-Glycosyltransferase superfamily protein (.1) AT2G26480 39 / 0.0002 UGT76D1 UDP-glucosyl transferase 76D1 (.1) AT3G46670 38 / 0.0004 UGT76E11 UDP-glucosyl transferase 76E11 (.1) AT2G15480 37 / 0.0008 UGT73B5 UDP-glucosyl transferase 73B5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014079 [exp] 103 / 2e-27 AT4G34131 483 / 3e-168 UDP-glucosyl transferase 73B3 (.1) Lus10014082 [exp] 45 / 1e-06 AT2G15480 483 / 3e-168 UDP-glucosyl transferase 73B5 (.1.2) Lus10022221 [exp] 42 / 1e-05 AT2G16890 479 / 1e-166 UDP-Glycosyltransferase superfamily protein (.1.2) Lus10019833 [exp] 42 / 1e-05 AT2G15480 483 / 2e-168 UDP-glucosyl transferase 73B5 (.1.2) Lus10019832 [exp] 41 / 5e-05 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3) Lus10019835 [exp] 40 / 0.0001 AT2G15480 476 / 3e-165 UDP-glucosyl transferase 73B5 (.1.2) Lus10014083 [exp] 39 / 0.0003 AT4G34131 489 / 2e-170 UDP-glucosyl transferase 73B3 (.1) Lus10014086 [exp] 38 / 0.0006 AT2G15490 496 / 4e-173 UDP-glycosyltransferase 73B4 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G099032 [exp] 57 / 1e-10 AT2G15490 558 / 0.0 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.001G303000 [exp] 49 / 5e-08 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1) Potri.001G303700 [exp] 49 / 6e-08 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2) Potri.001G303300 [exp] 49 / 7e-08 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2) Potri.001G303600 [exp] 49 / 8e-08 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1) Potri.001G303100 [exp] 47 / 2e-07 AT2G15490 414 / 1e-141 UDP-glycosyltransferase 73B4 (.1.2.3) Potri.009G098966 [exp] 44 / 2e-06 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10019836 pacid=23164096 polypeptide=Lus10019836 locus=Lus10019836.g ID=Lus10019836.BGIv1.0 annot-version=v1.0 ATGAAATGCTGGCCGCTAGTGACGAAAGTGGTGAAGATTGGAGTTAGGGTTGGGGTGGAACAGGGAGCGAGTTACGGAGGGATCGTGAAGAGTGACGCGA TTGAGATGGCGGTGAGAAGACTGATGGTGGAAGACAAAGGTGAAGTGATGCGGCGGCGGGTAAAGCTGCTGGGGAAGGCGGCGGCGGAAGCTGTTGAAGA AGGAGGATCTTCGTGGAATGATTTGGATGATCTGATACGTGAGCTTCAGTTCCAATTGCCGACGACTTTGGTGGAGATTCAGAATCGTTGTCCGTTGTTG TAA
AA sequence Show only first row Show all	>Lus10019836 pacid=23164096 polypeptide=Lus10019836 locus=Lus10019836.g ID=Lus10019836.BGIv1.0 annot-version=v1.0 MKCWPLVTKVVKIGVRVGVEQGASYGGIVKSDAIEMAVRRLMVEDKGEVMRRRVKLLGKAAAEAVEEGGSSWNDLDDLIRELQFQLPTTLVEIQNRCPLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Lus10019836 [exp]	0	1
AT4G10265			Wound-responsive family protei...		Lus10039760 [exp]	1.4	0.7405
AT2G28680			RmlC-like cupins superfamily p...		Lus10040867 [exp]	6.9	0.7019
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10000932 [exp]	10.5	0.7375
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10040560 [exp]	11.8	0.6986
AT1G44100		AAP5	amino acid permease 5 (.1)		Lus10042742 [exp]	13.5	0.7266
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031172 [exp]	15.1	0.7071
					Lus10038177 [exp]	17.0	0.6673
AT3G19950			RING/U-box superfamily protein...		Lus10018167 [exp]	20.2	0.6538
AT1G52560			HSP20-like chaperones superfam...		Lus10023653 [exp]	25.4	0.7049
AT3G24850	B3		Domain of unknown function (DU...		Lus10038802 [exp]	27.0	0.6772

Compare expression of checked genes

Lus10019836 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.