Lus10019842 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49780 254 / 7e-84 PUB26 plant U-box 26 (.1)
AT3G19380 231 / 1e-74 PUB25 plant U-box 25 (.1)
AT5G11550 72 / 8e-15 ARM repeat superfamily protein (.1)
AT3G49810 67 / 8e-13 ARM repeat superfamily protein (.1)
AT5G65920 64 / 5e-12 ARM repeat superfamily protein (.1)
AT3G52450 58 / 5e-10 PUB22 plant U-box 22 (.1)
AT5G37490 56 / 4e-09 ARM repeat superfamily protein (.1)
AT3G02840 56 / 4e-09 ARM repeat superfamily protein (.1)
AT4G16490 55 / 6e-09 ARM repeat superfamily protein (.1)
AT3G01400 55 / 7e-09 ARM repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014073 367 / 3e-129 AT1G49780 281 / 2e-92 plant U-box 26 (.1)
Lus10011691 77 / 3e-17 AT5G11550 160 / 2e-48 ARM repeat superfamily protein (.1)
Lus10040125 72 / 5e-15 AT3G02840 164 / 1e-48 ARM repeat superfamily protein (.1)
Lus10001079 72 / 1e-14 AT5G37490 290 / 1e-93 ARM repeat superfamily protein (.1)
Lus10010598 70 / 8e-14 AT3G49810 498 / 6e-176 ARM repeat superfamily protein (.1)
Lus10013584 57 / 1e-09 AT2G35930 471 / 2e-165 plant U-box 23 (.1)
Lus10021267 57 / 2e-09 AT2G35930 474 / 5e-167 plant U-box 23 (.1)
Lus10007738 56 / 6e-09 AT3G01400 555 / 0.0 ARM repeat superfamily protein (.1)
Lus10016565 55 / 9e-09 AT3G46510 884 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G140100 311 / 3e-106 AT1G49780 517 / 0.0 plant U-box 26 (.1)
Potri.009G100200 311 / 5e-106 AT1G49780 515 / 0.0 plant U-box 26 (.1)
Potri.006G240400 89 / 8e-21 AT5G11550 179 / 1e-53 ARM repeat superfamily protein (.1)
Potri.015G031000 72 / 1e-14 AT5G37490 323 / 9e-107 ARM repeat superfamily protein (.1)
Potri.007G105300 71 / 2e-14 AT1G49780 157 / 8e-44 plant U-box 26 (.1)
Potri.002G116600 71 / 4e-14 AT3G49810 546 / 0.0 ARM repeat superfamily protein (.1)
Potri.012G042600 70 / 7e-14 AT5G37490 294 / 2e-95 ARM repeat superfamily protein (.1)
Potri.006G277700 70 / 7e-14 AT3G49810 498 / 3e-175 ARM repeat superfamily protein (.1)
Potri.005G063700 67 / 8e-13 AT1G49780 139 / 3e-37 plant U-box 26 (.1)
Potri.016G069400 64 / 5e-12 AT3G52450 511 / 0.0 plant U-box 22 (.1)
PFAM info
Representative CDS sequence
>Lus10019842 pacid=23164091 polypeptide=Lus10019842 locus=Lus10019842.g ID=Lus10019842.BGIv1.0 annot-version=v1.0
ATGGAGGCGCGGGTGTCCTGCGCGGCGGTGATCGAGATGGTCGTCGTCGGGACTCGGTGCTCCGATCTGAGGGCTCAGATCTCGTCCGTCGACGAGATCC
ACGAAGGAGTGGTGGAGATGTTAAGAAATCCATTCCCATATCCCCGCGCTCTAAAAGTAGGAATCAAGGCTCTGTTCGCTCTCTGCCTAGCCAAACAAAC
TCGCCACAAGGCGATTGCAGCCGGCGCAGCAGAGACGCTCGTCGACAGGCTAGCAGACTTCGACAAGTGCGACGCCGAGCGCGCTCTGGCAACCATGGAG
CTCCTCTGCCGCGTTCCGTCAGGGTGCGAAGCTCTCGCAGATCACGCGCTGACAGTTCCTCTGCTCGTGAAAACAATACTTAAGATCTCCGATAGAGCAA
CGGAGTACGCCGCCGGAGCTCTCCTCGCTCTTTGCTCCTCATCCGAGCAGTGCCAGAGGGAAGCCGTCAGGGCCGGAATACTTACTCAGATGCTTCTCCT
CGTGCAGAGCGACTGCACGGACAGGGCGAAGAGGAAAGCTCAGATGCTTTTGAAACTGATGAGGGACTCCTGGCCGGAGGATTCGTCAGGATACTCCGAC
GACTTCGTTTACAGCGAGGTCGTCCCCTTTTGA
AA sequence
>Lus10019842 pacid=23164091 polypeptide=Lus10019842 locus=Lus10019842.g ID=Lus10019842.BGIv1.0 annot-version=v1.0
MEARVSCAAVIEMVVVGTRCSDLRAQISSVDEIHEGVVEMLRNPFPYPRALKVGIKALFALCLAKQTRHKAIAAGAAETLVDRLADFDKCDAERALATME
LLCRVPSGCEALADHALTVPLLVKTILKISDRATEYAAGALLALCSSSEQCQREAVRAGILTQMLLLVQSDCTDRAKRKAQMLLKLMRDSWPEDSSGYSD
DFVYSEVVPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G49780 PUB26 plant U-box 26 (.1) Lus10019842 0 1
AT2G02130 PDF2.3, LCR68 low-molecular-weight cysteine-... Lus10004289 5.3 0.8909
AT3G23880 F-box and associated interacti... Lus10008870 7.1 0.8725
AT4G03600 unknown protein Lus10018599 9.9 0.8483
Lus10014171 11.9 0.8709
AT1G27170 transmembrane receptors;ATP bi... Lus10032101 12.0 0.8577
AT4G03600 unknown protein Lus10039834 12.4 0.8525
AT2G36330 Uncharacterised protein family... Lus10002372 15.9 0.8512
AT1G49780 PUB26 plant U-box 26 (.1) Lus10014073 16.4 0.8283
AT2G35940 HD BLH1, EDA29 embryo sac development arrest ... Lus10029405 16.5 0.8698
AT2G39840 TOPP4 type one serine/threonine prot... Lus10011827 20.6 0.8607

Lus10019842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.