Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27710 88 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4) AT3G44590 83 / 9e-22 60S acidic ribosomal protein family (.1.2) AT2G27720 81 / 7e-21 60S acidic ribosomal protein family (.1.2.3) AT3G28500 81 / 8e-21 60S acidic ribosomal protein family (.1) AT5G40040 78 / 7e-20 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014070 [exp] 115 / 1e-34 AT2G27710 92 / 1e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10043377 [exp] 104 / 2e-29 AT2G27710 102 / 8e-29 60S acidic ribosomal protein family (.1.2.3.4) Lus10026714 [exp] 100 / 9e-29 AT3G44590 96 / 6e-27 60S acidic ribosomal protein family (.1.2) Lus10006270 [exp] 103 / 2e-28 AT2G27710 100 / 9e-27 60S acidic ribosomal protein family (.1.2.3.4) Lus10019533 [exp] 105 / 3e-28 AT3G44620 262 / 6e-87 protein tyrosine phosphatases;protein tyrosine phosphatases (.1.2) Lus10020575 [exp] 99 / 3e-28 AT3G44590 100 / 9e-29 60S acidic ribosomal protein family (.1.2) Lus10026712 [exp] 102 / 1e-27 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G146200 [exp] 100 / 2e-28 AT2G27710 89 / 2e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.004G185800 [exp] 98 / 8e-28 AT2G27710 89 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.010G236400 [exp] 84 / 2e-22 AT2G27710 90 / 1e-24 60S acidic ribosomal protein family (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10019846 pacid=23164026 polypeptide=Lus10019846 locus=Lus10019846.g ID=Lus10019846.BGIv1.0 annot-version=v1.0 ATGAAGGTTGTCGCCGCCTACCTGCTGGCCGTCCTGGGAGGCAACACCGCTCCCACCGCCGACGACTTGAAGTCCATCCTGGGAAGCGTGGGTGCTGATG CCGACGATGCTATGATCGAGCTGCTATTCTCTCAAGCGAAAGGAAGAGACGTCGCCGAGTTGATTGCAGTTGGTATGGAGAAGATGGCTGCTTCGGTTCC TTCTGGTGGCGTTGCTGCTCCGGTGGAAGGTGGTGGTGGTGCTGCAGCAGCTCCGGCAGCTGTAGCGGCCATGAAGGAGGAAGAAGCAGCGGAGGAAGGG GAGTCTGATGAGGAGATGTGCCTCGACTTGTTCGGCTAA
AA sequence Show only first row Show all	>Lus10019846 pacid=23164026 polypeptide=Lus10019846 locus=Lus10019846.g ID=Lus10019846.BGIv1.0 annot-version=v1.0 MKVVAAYLLAVLGGNTAPTADDLKSILGSVGADADDAMIELLFSQAKGRDVAELIAVGMEKMAASVPSGGVAAPVEGGGGAAAAPAAVAAMKEEEAAEEG ESDEEMCLDLFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27710			60S acidic ribosomal protein f...		Lus10019846 [exp]	0	1
AT1G11410			S-locus lectin protein kinase ...		Lus10007610 [exp]	3.5	0.7980
AT5G45420	MYB	maMYB	membrane anchored MYB, Duplica...		Lus10036429 [exp]	8.1	0.7739
AT2G40740	WRKY	ATWRKY55, WRKY5...	WRKY DNA-binding protein 55 (....		Lus10034245 [exp]	10.6	0.8137
AT5G17350			unknown protein		Lus10017620 [exp]	13.9	0.7634
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10001493 [exp]	16.9	0.7790
					Lus10002306 [exp]	17.3	0.7418
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	18.3	0.7857
AT4G23470			PLAC8 family protein (.1.2.3)		Lus10018826 [exp]	23.0	0.7629
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10039454 [exp]	38.9	0.7803
AT5G57550		XTR3, XTH25, EX...	xyloglucan endotransglycosylas...		Lus10012834 [exp]	45.4	0.6434

Compare expression of checked genes

Lus10019846 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.