Lus10019847 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15570 184 / 6e-60 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
AT3G15360 110 / 1e-30 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
AT1G03680 102 / 6e-28 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
AT4G03520 100 / 1e-26 ATHM2 Thioredoxin superfamily protein (.1.2)
AT1G76760 76 / 2e-17 ATY1, TRX-Y1 thioredoxin Y1 (.1)
AT1G43560 71 / 9e-16 ATY2 thioredoxin Y2 (.1)
AT1G50320 69 / 1e-14 ATHX, ATX thioredoxin X (.1)
AT1G52990 68 / 6e-14 thioredoxin family protein (.1)
AT4G12170 65 / 9e-14 Thioredoxin superfamily protein (.1)
AT3G06730 61 / 8e-12 TRXz, TRXP ,TRX z thioredoxin putative plastidic, Thioredoxin z (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014069 342 / 3e-122 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Lus10014798 121 / 3e-35 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10040887 121 / 4e-35 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029755 115 / 1e-32 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029752 114 / 2e-32 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10042784 114 / 3e-32 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10018875 69 / 5e-15 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1)
Lus10028569 69 / 8e-15 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1)
Lus10039499 61 / 1e-11 AT3G06730 238 / 9e-81 thioredoxin putative plastidic, Thioredoxin z (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G100700 214 / 9e-72 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Potri.001G401500 127 / 2e-37 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Potri.005G058400 126 / 5e-37 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2)
Potri.011G120700 125 / 1e-36 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Potri.005G186800 114 / 4e-32 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2)
Potri.019G111200 114 / 5e-32 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2)
Potri.002G073000 113 / 1e-31 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2)
Potri.013G132200 110 / 9e-31 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2)
Potri.002G066800 72 / 4e-16 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
Potri.007G074000 69 / 7e-15 AT1G50320 201 / 3e-66 thioredoxin X (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10019847 pacid=23163960 polypeptide=Lus10019847 locus=Lus10019847.g ID=Lus10019847.BGIv1.0 annot-version=v1.0
ATGGCTACTTCTGCTTCCACGTGCTTCCGCGCTCTTCCTCTCCCCGCTTCACTCCAGCTCCGTCCAGCAGCGCAACTCAGTTCTAGCTCAGCAGTTTCTT
TCCCGTTCGACTTCTCCGCCGACGTGAGAGGTGGATTAGCCCTCCGTTCAACCAACTCGCGTCCGTCTTCTCCCTTCAAGGTCGTCTGCATGCGTGGATC
CAAAGCAGCTGTTGTCACCAAGGACTCATGGGAGAAGTCGATCCTGAAAAGCAATACCCCCGTGTTAGTCGAGTTCCATGCAAGCTGGTGTGGGCCCTGT
AAGATGGTTCACCGCGTTATTGATGAGCTTGCTGTAGAATACGAAGGGAAAATCCAATGCTTTGTCCTCAACGCCGACAATGATATAAAAATCGCTGAGG
ACTACCAGATCAAGGCTGTACCAGTGGTCCTGCTTTTCAAGAACGGTGAAAAGCGAGAGACTGTTGTCGGAACCATGCCCAAGGAATTCTACGCTGCTGC
CATCGAGAGGGTTCTGAAGGCATGA
AA sequence
>Lus10019847 pacid=23163960 polypeptide=Lus10019847 locus=Lus10019847.g ID=Lus10019847.BGIv1.0 annot-version=v1.0
MATSASTCFRALPLPASLQLRPAAQLSSSSAVSFPFDFSADVRGGLALRSTNSRPSSPFKVVCMRGSKAAVVTKDSWEKSILKSNTPVLVEFHASWCGPC
KMVHRVIDELAVEYEGKIQCFVLNADNDIKIAEDYQIKAVPVVLLFKNGEKRETVVGTMPKEFYAAAIERVLKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15570 TRX-M3, GAT1, A... THIOREDOXIN-M3, GFP ARRESTED T... Lus10019847 0 1
AT4G29120 6-phosphogluconate dehydrogena... Lus10012950 1.4 0.8790
Lus10023370 3.7 0.8830
AT4G21350 PUB8, B80 plant U-box 8 (.1) Lus10020077 8.0 0.8659
AT4G24570 DIC2 dicarboxylate carrier 2 (.1) Lus10015570 10.7 0.8682
AT4G16490 ARM repeat superfamily protein... Lus10039047 15.2 0.8442
AT1G47750 PEX11A peroxin 11A (.1) Lus10029260 16.1 0.8519
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10019769 18.0 0.8384
AT5G16080 ATCXE17 carboxyesterase 17 (.1) Lus10041632 20.2 0.8209
AT1G55265 Protein of unknown function, D... Lus10013756 20.3 0.8285
AT5G48150 GRAS PAT1 phytochrome a signal transduct... Lus10006369 25.7 0.8322

Lus10019847 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.