Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25315 132 / 2e-41 Expressed protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014065 [exp] 219 / 5e-76 AT4G25315 131 / 4e-41 Expressed protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G189300 [exp] 152 / 2e-49 AT4G25315 138 / 7e-44 Expressed protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF11326 [flax] [poplar] DUF3128 Protein of unknown function (DUF3128)
Representative CDS sequence Show only first row Show all	>Lus10019851 pacid=23164008 polypeptide=Lus10019851 locus=Lus10019851.g ID=Lus10019851.BGIv1.0 annot-version=v1.0 ATGGAATCGGAATCGGAGGAGGTGAGTACAGCGACGCGCCGTCGTTTGTCATGCACAAAGCACTTTGATGCCCTCTGGTTCTGCTATTCTCCGGTCCATC AGATGCAGCAGTATTATAGGGCGGGAGTGCTCGACAATTGTTCAGGGAAATGGAGTGCTCTCTATGACTGCTTGACTCTCAAGACCAAGAGGTCTTCCGA ACTCGAGGATATACTGGAGACTCGTGAGAAAGCCAAAACTCACATCTGGACTTTCAGGAATAAGGAGGAAGCGGCGGTATACTGGAAGGAGCTATTCGGA GACATGGATGAAGTCGAATGA
AA sequence Show only first row Show all	>Lus10019851 pacid=23164008 polypeptide=Lus10019851 locus=Lus10019851.g ID=Lus10019851.BGIv1.0 annot-version=v1.0 MESESEEVSTATRRRLSCTKHFDALWFCYSPVHQMQQYYRAGVLDNCSGKWSALYDCLTLKTKRSSELEDILETREKAKTHIWTFRNKEEAAVYWKELFG DMDEVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25315			Expressed protein (.1.2)		Lus10019851 [exp]	0	1
AT4G14420			HR-like lesion-inducing protei...		Lus10021877 [exp]	3.6	0.8750
AT4G39280			phenylalanyl-tRNA synthetase, ...		Lus10014563 [exp]	9.2	0.8552
AT4G09890			Protein of unknown function (D...		Lus10020842 [exp]	15.4	0.8680
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10027617 [exp]	16.4	0.7643
AT5G27950			P-loop containing nucleoside t...		Lus10018999 [exp]	18.8	0.8211
AT3G01330	E2F_DP	E2FF, E2L2, DEL...	E2F-LIKE 2, DP-E2F-like protei...		Lus10005840 [exp]	19.5	0.8332
AT1G70350			unknown protein		Lus10013008 [exp]	21.9	0.8290
AT3G61060		ATPP2-A13	phloem protein 2-A13 (.1.2)		Lus10005769 [exp]	23.1	0.8377
AT2G20450			Ribosomal protein L14 (.1)		Lus10024918 [exp]	27.5	0.8173
AT1G13245		RTFL17, DVL4	DEVIL 4, ROTUNDIFOLIA like 17 ...		Lus10041491 [exp]	42.0	0.8403

Compare expression of checked genes

Lus10019851 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.