Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12750 84 / 1e-20 ZIP1 zinc transporter 1 precursor (.1) AT1G05300 82 / 1e-19 ZIP5 zinc transporter 5 precursor (.1.2) AT4G19680 80 / 4e-19 ATIRT2, IRT2 iron regulated transporter 2 (.1.2) AT1G31260 79 / 9e-19 ZIP10 zinc transporter 10 precursor (.1) AT2G32270 75 / 2e-17 ZIP3 zinc transporter 3 precursor (.1) AT4G33020 74 / 5e-17 ATZIP9, ZIP9 ZIP metal ion transporter family (.1) AT4G19690 74 / 1e-16 ATIRT1, IRT1 ARABIDOPSIS IRON-REGULATED TRANSPORTER 1, iron-regulated transporter 1 (.1.2) AT1G60960 72 / 3e-16 ATIRT3, IRT3 iron regulated transporter 3 (.1) AT1G10970 71 / 7e-16 ATZIP4, ZIP4 zinc transporter 4 precursor (.1) AT2G30080 70 / 2e-15 ATZIP6, ZIP6 ZIP metal ion transporter family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014063 [exp] 189 / 9e-61 AT3G12750 262 / 2e-85 zinc transporter 1 precursor (.1) Lus10014062 [exp] 121 / 1e-34 AT3G12750 318 / 3e-107 zinc transporter 1 precursor (.1) Lus10019854 [exp] 117 / 1e-33 AT3G12750 280 / 6e-94 zinc transporter 1 precursor (.1) Lus10024107 [exp] 96 / 1e-24 AT3G12750 394 / 4e-137 zinc transporter 1 precursor (.1) Lus10041613 [exp] 95 / 2e-24 AT3G12750 397 / 1e-138 zinc transporter 1 precursor (.1) Lus10041647 [exp] 91 / 6e-23 AT3G12750 383 / 2e-132 zinc transporter 1 precursor (.1) Lus10040615 [exp] 81 / 3e-19 AT1G31260 437 / 6e-154 zinc transporter 10 precursor (.1) Lus10031307 [exp] 72 / 3e-17 AT2G30080 264 / 2e-89 ZIP metal ion transporter family (.1) Lus10031872 [exp] 71 / 2e-16 AT2G30080 157 / 6e-47 ZIP metal ion transporter family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G173300 [exp] 94 / 3e-24 AT3G12750 339 / 2e-115 zinc transporter 1 precursor (.1) Potri.006G006800 [exp] 91 / 4e-23 AT1G05300 322 / 6e-109 zinc transporter 5 precursor (.1.2) Potri.008G083100 [exp] 91 / 4e-23 AT3G12750 350 / 7e-120 zinc transporter 1 precursor (.1) Potri.006G006900 [exp] 88 / 7e-23 AT1G05300 187 / 2e-58 zinc transporter 5 precursor (.1.2) Potri.006G006600 [exp] 87 / 2e-21 AT1G05300 328 / 2e-111 zinc transporter 5 precursor (.1.2) Potri.001G160400 [exp] 86 / 4e-21 AT3G12750 320 / 5e-108 zinc transporter 1 precursor (.1) Potri.015G117900 [exp] 81 / 2e-19 AT4G19690 443 / 2e-156 ARABIDOPSIS IRON-REGULATED TRANSPORTER 1, iron-regulated transporter 1 (.1.2) Potri.015G117700 [exp] 80 / 4e-19 AT1G31260 436 / 5e-154 zinc transporter 10 precursor (.1) Potri.018G053300 [exp] 78 / 3e-18 AT1G10970 440 / 3e-153 zinc transporter 4 precursor (.1) Potri.010G135400 [exp] 76 / 1e-17 AT2G04032 325 / 4e-110 zinc transporter 7 precursor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0184 [flax] [poplar] DMT PF02535 [flax] [poplar] Zip ZIP Zinc transporter
Representative CDS sequence Show only first row Show all	>Lus10019853 pacid=23163967 polypeptide=Lus10019853 locus=Lus10019853.g ID=Lus10019853.BGIv1.0 annot-version=v1.0 ATGAAGGTGGTAATAAGGGTGGTTATGGCGTTGATCTTCACAGCCATAGCTCCTGTGGGGATTGGAATTGGAATGGGGATATCAAACCATTACAAGGATA ACAGTTCGACTTGTCTAATCATGGAGGGACTTTTCCATTCAGCATCAGCTGGGATTATAATTTACATGGCTATTATCAACTTGTTGGCCACACATTTCAT GAGCTTGAAGATGTTGTCCTCTGATTTCAGAATTCAATTCGGGAGTTTTACTTCTCTTATCCTTGGAGCTGCTTCCATGTCCCTCTTGAACATTCTTTAT TGA
AA sequence Show only first row Show all	>Lus10019853 pacid=23163967 polypeptide=Lus10019853 locus=Lus10019853.g ID=Lus10019853.BGIv1.0 annot-version=v1.0 MKVVIRVVMALIFTAIAPVGIGIGMGISNHYKDNSSTCLIMEGLFHSASAGIIIYMAIINLLATHFMSLKMLSSDFRIQFGSFTSLILGAASMSLLNILY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	0	1
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10036457 [exp]	1.7	1.0000
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	2.4	1.0000
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	3.5	1.0000
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	4.0	1.0000
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10042370 [exp]	5.0	0.9876
AT4G13250		NYC1, NYC	NON-YELLOW COLORING 1, NAD(P)-...		Lus10034917 [exp]	5.5	0.9875
AT3G43860		ATGH9A4	glycosyl hydrolase 9A4 (.1)		Lus10009794 [exp]	5.9	0.9827
AT3G07070			Protein kinase superfamily pro...		Lus10011866 [exp]	6.3	0.9703
AT4G15610			Uncharacterised protein family...		Lus10033972 [exp]	6.7	0.9626
AT5G04347			Plant self-incompatibility pro...		Lus10016171 [exp]	6.8	0.8672

Compare expression of checked genes

Lus10019853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.